(data stored in ACNUC10821 zone)

EMBL: AE017262.PE11

AE017262.PE11        Location/Qualifiers
FT   CDS_pept        12917..13885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0011"
FT                   /product="mevalonate kinase"
FT                   /note="identified by similarity to GP:9937379; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   TIGR00549"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02801"
FT                   /protein_id="AAT02801.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVENSTKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGKGECVAIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFSKKITFVVADTGVPSETRDAVKDVQALYKENQTEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIEVARSSGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKELHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
     ttggctacag gcattgggac agctaaaatg atattatgcg gagaacatgc agttgtatac        60
     ggagaaccgg caatttcagt cccatttaca caagcagttg taacgacaaa tgtagaaaat       120
     tctacaaaaa ccaaattttc ttcggcattt ttttcaggtg atttagatga tatgcctgat       180
     ttcttagcag gaatcaaagc attagttgta gatgttttaa atgagattgg aaaaggcgaa       240
     tgcgttgcta tccatgtagt ttcaggtgtt ccaattggtc gtggattagg ttcaagtgcc       300
     gctgtagcaa caagtattgc gcgtggctta tataaatatt ttaatcaaga attagactcg       360
     aaaaaattat tagccattgt gaatgcggca gaaaaaattg ctcatggaaa tgctagtggt       420
     gttgatgcta tcacggttgt gagtgaaaaa ccagtatggt atgagcgaga tcgaaaacta       480
     gaaattatgc atttttcaaa aaaaatcacg ttcgtagtag cagatactgg agttccaagt       540
     gaaaccagag acgcggtgaa ggatgttcaa gctttatata aagaaaatca aacagaaatt       600
     ggtaaaataa ttcatcaact cggcgatatt tcccgggaaa taaagactca tttagaaggc       660
     gatgcagata ctgtgaaaat aggtgctgca atgaataagg cacaatctta tttagaaact       720
     ttgacagtaa gtgatagtag tttagagaaa ttaatagaag tagctagaag tagtggtgca       780
     gacggggcaa aacttacagg tggcggtaga ggtggatgta ttatcgctgt agcaaaaaat       840
     caagaaatcg ctgaacaaat aacgaaggag cttcataatg ctggagctgc acaagaatgg       900
     atttttacga ttggagaagg tagttatgag agcgacagcc atcgcacaca cgaatgtggc       960
     gctaattaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page