(data stored in ACNUC10821 zone)

EMBL: AE017262.PE113

AE017262.PE113       Location/Qualifiers
FT   CDS_pept        116098..117009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0115"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613; match to protein family HMM
FT                   TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02903"
FT                   /protein_id="AAT02903.1"
FT                   /translation="MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKTKEDRSQALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
     atggcagaaa aaatcgaatt atcaaagaga gaccgtctac gcgtagcatg gcgctctacg        60
     ttcattcaag gttcatggaa ctacgaacgt atgcaaaatg gtggctgggc attctctatg       120
     attcccgcta ttaaaaaatt atataaaact aaagaagatc gttcgcaagc tctaaaacgt       180
     cacttagaat tctttaatac acatccatat attgcatctc caattctagg ggtaacactt       240
     gctcttgaag aagaacgtgc caatggagca gaagttgatg atgtagcaat tcaaggggtt       300
     aaagttggta tgatgggacc tctagctggt gttggtgatc cagtattctg gtttacaatt       360
     cgtccaatgt taggagcatt aggtgcttct cttgccttga gtggaaacat tcttggacca       420
     atcttattct tcgttgcttg gaacgtaatc cgttggggct tcatgtggta tacacaagaa       480
     ttcggctaca aagctggttc taaaattact gatgaccttt ctggtggatt actacaagac       540
     attacaaaag gtgcttcgat actcgggatg ttcgtcctcg ccgccttggt gcagagatgg       600
     gtaaatatcc agtttgcgcc aattatctcg aaagttaaac ttgatgaagg tgcgtatatt       660
     gattggagtc atcttccaca aggcgctcaa ggtatcaaaa ctgctttaga acaacaacaa       720
     gcaggtttag ctctttctga aattaaagta acaaccttgc aaaataactt ggataactta       780
     atcccaggac ttgcagcagt agctcttaca ttcctatgta tgtggttact taagaaaaaa       840
     atcagcccaa ttatcatcat tctaggtcta ttcgtagttg gtatagttgg tcacttaatc       900
     gggcttctgt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page