(data stored in ACNUC10821 zone)

EMBL: AE017262.PE114

AE017262.PE114       Location/Qualifiers
FT   CDS_pept        117136..117525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412565; match to
FT                   protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02904"
FT                   /protein_id="AAT02904.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKRPKEVLRKIRVYVDPANMV
FT                   SSLSFFDVMKRSFRSIFSKKKNKNK"
     ttggttcaat cgattaatac aaaggtagac ttaacaatag atgccaccgc gtatactgga        60
     cttacagatt acgggaaaat tatgattggc gacaaaggtt ttgaattttt taactcacgt       120
     gatgtgcgta aattcgtcca aatcccttgg gaagaagtag atcaagttat cgtatccgtt       180
     atgctaaaag gtaagtggat ccctcgctac gccattaaaa caaagcgcaa cggcacatac       240
     acatttgctt ctaaacgacc taaagaagtt ttacgtaaaa tacgagttta tgtcgaccca       300
     gccaatatgg tgagctcgct cagtttcttt gatgttatga agcgctcgtt tcggtcgata       360
     tttagcaaga aaaaaaacaa aaataaataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page