(data stored in ACNUC10821 zone)

EMBL: AE017262.PE116

AE017262.PE116       Location/Qualifiers
FT   CDS_pept        complement(118038..119555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02906"
FT                   /protein_id="AAT02906.1"
FT                   /translation="MRPTNVYTPEDIYLKDRTGFNNGNLAYQYSIYRALWNDDVEIHAD
FT                   GLSSNPNLAEKINENYDLYVMPLADAFRDDFRPVLRNYTQLIRKLKIPVIVTGVGLRAN
FT                   YEPQLDEGFSFDEDVTNFVKAVLEKSAQIGVRGQITADYLKKLGFNAELDFRVIGCPSL
FT                   YTFGREIKIRDFHLTDQSTIAINASPTSSEIAINFLNNMITTYKDYHFIPQHLDEFHLM
FT                   YAGGPDISSDINGYPTNIQHKYYQEGRVKYFTSMPSWFDFVKKVDFSIGSRLHGNVIPT
FT                   IVGTPNISFVQDARMRELASYHALPHVTIDELEKTNNLQELLTKVDLKSAEKVQARNFD
FT                   NYIDFLDTNGLNHIYKYDKNRKSAPMDELINSITFPTSPDPISILNPQEMLNRVKISTN
FT                   LLKERHDFSTRYRVNLVNNQLTQLKKTTSEQNKKYQQKITETQEKNQQLEKQLTDTKQK
FT                   LQLTINKNHELTNKIRHYQGTLNRKSVKTTLKVANSLANLKKKVSRS"
     atgcgaccga ccaatgtcta cacgccggaa gacatctatt taaaggatcg aaccgggttt        60
     aacaatggta atcttgcgta tcaatatagc atttatcgag ctttgtggaa tgatgatgta       120
     gaaatacatg ctgacggtct ttcatctaac cccaatctcg cagaaaaaat caatgaaaat       180
     tacgacctct atgttatgcc tttagctgac gcatttcgag acgactttag gccagtactc       240
     cgcaattaca cccaactcat tcgcaaatta aaaatcccag tcatcgtaac aggcgtcggg       300
     ttaagagcga attacgaacc acaactagac gaaggttttt cttttgatga agatgttact       360
     aactttgtta aagcagtcct agaaaaatca gctcaaattg gggttcgagg acaaattact       420
     gcagattatt taaaaaaact aggatttaac gcagaacttg acttccgagt aattggttgt       480
     ccgtcccttt atacattcgg acgagaaata aaaataagag attttcactt aacagatcaa       540
     tccaccatcg ctattaatgc atccccaact tcttcagaaa tagctatcaa tttccttaac       600
     aacatgatta ctacatataa agactatcac tttatccctc aacacctaga cgaattccat       660
     ttaatgtatg ccggcggtcc agatatctct agtgatatca atggctaccc aacaaatatc       720
     caacataagt attatcaaga aggtcgagta aaatatttca ctagcatgcc tagttggttc       780
     gattttgtga agaaagttga ttttagcatt ggctctcgcc tacatggaaa cgtcattcca       840
     acaatagtcg gaacacctaa tatttctttc gtacaagatg ccagaatgcg tgaactagct       900
     tcctaccatg cgcttcctca cgtaaccatc gatgaattag aaaaaaccaa caacctccaa       960
     gaattactaa ctaaagtgga cctgaaatca gccgaaaaag tccaagcaag aaattttgat      1020
     aattatattg atttcttaga tactaatggt ctcaatcata tctataaata cgataaaaac      1080
     agaaaatcag ctcccatgga tgaacttata aactccatta ctttcccaac aagtccagac      1140
     cccatttcca tattaaaccc tcaagaaatg ctaaaccgag taaaaatctc caccaattta      1200
     ttaaaagaaa gacatgattt tagcacaaga taccgcgtca atctcgtaaa taatcaactt      1260
     acccaactga aaaaaacaac ttctgaacaa aacaaaaaat accaacaaaa aattactgaa      1320
     acacaagaaa aaaatcagca attagaaaaa caactgacag atactaaaca aaaattacag      1380
     ttgacgatta ataaaaatca cgaactaact aataaaatca gacattatca aggaacatta      1440
     aaccgaaaat ctgtaaaaac tactttaaaa gtagcgaact ctctagcaaa tttaaaaaag      1500
     aaagtctcca gaagctaa                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page