(data stored in ACNUC10821 zone)

EMBL: AE017262.PE117

AE017262.PE117       Location/Qualifiers
FT   CDS_pept        complement(119670..119963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0119"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02907"
FT                   /protein_id="AAT02907.1"
FT                   /translation="MKKLNELSKSDLLLIFQALSDPIRLDIFLCLLKSKEKRFSGTTYN
FT                   ISKSTMSHHIKLLKEAKLINLRKEGTTHIYSVNEALVEEIGYFFDACKHNHK"
     atgaaaaagt taaatgagct ctcaaaatca gatttattat taattttcca agcattaagc        60
     gatccaatcc gtcttgatat tttcctatgt ttactgaaaa gcaaagaaaa acgcttctct       120
     ggcacaactt acaatatctc caaatctacc atgtctcacc acattaaact gcttaaagaa       180
     gcaaaactta ttaatttaag aaaggaagga accacgcata tttattcggt gaatgaagca       240
     ttagtggaag aaatcggcta cttctttgat gcatgtaaac ataatcacaa ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page