(data stored in ACNUC10821 zone)

EMBL: AE017262.PE118

AE017262.PE118       Location/Qualifiers
FT   CDS_pept        120075..120365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0120"
FT                   /product="YneC family protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02908"
FT                   /protein_id="AAT02908.1"
FT                   /translation="MLHIEAQITVKKEQTEAFLQAAKEVIAASRAEAGNHGYELVQSTE
FT                   NETVFYMLEKWADMEAIQQHNDSEHFKKFQKLAADFVAKELEISVLTPLAR"
     atgttgcata ttgaagcgca aattacggtc aaaaaagaac aaaccgaagc ttttttgcag        60
     gcggctaagg aagttattgc tgcatcaaga gcagaagctg ggaatcatgg ttatgaatta       120
     gtacaatcaa cagaaaacga aacagttttt tatatgttag aaaaatgggc ggatatggaa       180
     gccattcaac aacacaacga cagcgagcat ttcaaaaaat tccagaaatt ggctgctgat       240
     tttgttgcta aagaacttga aatttcagta ttaacgccac ttgcgcgata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page