(data stored in ACNUC10821 zone)

EMBL: AE017262.PE120

AE017262.PE120       Location/Qualifiers
FT   CDS_pept        121107..121478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0150"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02910"
FT                   /protein_id="AAT02910.1"
FT                   /translation="MTIKITRKTGIGSGITPVKIRIENEEIVKLDNHQSHFFMPKMEKT
FT                   KVCVTNWFYGSQEAVLENNNDVIVRINRKALILNYSMFPFLFFGLLATSWESTVIALIL
FT                   CLASFFYSRKHWFEFVKIK"
     atgactatca aaataactcg taaaactgga attggcagcg gtattactcc ggtgaaaatt        60
     agaatcgaaa atgaagaaat tgtaaaactc gacaatcatc agtctcattt ttttatgcct       120
     aagatggaga aaacaaaggt ttgcgtgact aattggtttt atgggagtca ggaagcggtt       180
     ttggaaaata ataatgatgt tattgtgcgg attaaccgta aagcactaat attaaattat       240
     tcaatgtttc catttctttt tttcggactt ttggccacta gttgggagtc tacagtcatt       300
     gcgttaatac tttgtttggc atcctttttt tattcgcgaa agcattggtt tgaatttgtg       360
     aaaattaaat aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page