(data stored in ACNUC10821 zone)

EMBL: AE017262.PE125

AE017262.PE125       Location/Qualifiers
FT   CDS_pept        128728..129561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0127"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02915"
FT                   /protein_id="AAT02915.1"
FT                   /translation="MLKINTTTFNPQILYIANCYTNEVRVGENHHHDFLEISIICEGNV
FT                   IYDIEGERVKLGKGDMLIFNPGVNHYDITEPGMTNAQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKKEEESAILSISKQIIEEKDAEKPGYDLILKAFVMQLIIHVLREATPEQLENNGV
FT                   KLSTDEQQKQILVNEIIHYMEKHHTEDVSLSTLSQTMYISPAYISKVFKEETGESPINY
FT                   LIKIRLTRAEELLKNKDVTVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
     atgctgaaaa taaatacgac cacatttaat ccgcaaattt tgtatatcgc gaattgttat        60
     acgaatgagg tgcgcgtagg tgaaaatcac catcatgatt ttttggagat ctcgattatt       120
     tgtgagggaa acgttattta tgatattgaa ggcgagcgag tcaaactagg aaaaggtgat       180
     atgctgattt ttaatcctgg tgtgaatcat tacgatataa ccgaaccagg tatgacgaat       240
     gcgcaactcc atataggttt tcggaacttt gcactggaag gatacacgcg aaatacgttc       300
     ccgtttaaaa aggccttttt acgaaaaaaa gaagaagaat ctgccatttt atctatttct       360
     aaacaaatta tagaagaaaa agacgcagaa aaaccaggat atgacttgat tttaaaggct       420
     ttcgtcatgc aattaattat ccatgtttta cgcgaagcca ccccagaaca acttgaaaat       480
     aacggcgtca aattatctac cgacgagcag caaaaacaga tacttgtaaa cgaaattatt       540
     cattatatgg aaaaacacca cacagaagac gtctcgctct caacgctttc gcaaacgatg       600
     tacattagcc ccgcctatat ctccaaagta tttaaagaag aaaccgggga atcaccaatt       660
     aactacttaa tcaaaattcg tcttactcgt gcagaagaat tactcaagaa taaagacgtt       720
     accgtaaaac aggccgcaaa tatggtcgga tataatgatg cttattattt tagcaagctt       780
     ttcaagaaat attacgggtt tccaccatca gaaaactggc gcaaatcgag ttag             834
//

If you have problems or comments...

PBIL Back to PBIL home page