(data stored in ACNUC10821 zone)

EMBL: AE017262.PE128

AE017262.PE128       Location/Qualifiers
FT   CDS_pept        complement(131495..132190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0157"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02918"
FT                   /protein_id="AAT02918.1"
FT                   /translation="MFHTIDFSDIFSSDYSNKISFKKGEIIHSYRDYEEKTPQIGAILE
FT                   GTAVLEGPTNEGRWMINALIGQHSLFGMESLLETKTAPELTEYRVRALENGTVLFIDRE
FT                   FLLNYLYANPQFFHLILDEVIVRYLFTSKNYKNINQAPIVKVTRILVEIIELLHLHQTE
FT                   GAIELPVYVTQTFLADYCRSSRARVTEVLEELRESGLLLSKKPITISSHENLLNQIDSF
FT                   QTGNGLLTR"
     atgtttcaca cgatagattt ttcagatatt ttttctagtg attattcaaa taagatttct        60
     tttaaaaaag gcgaaattat tcattcatat agagattacg aagaaaagac gccgcaaata       120
     ggtgctattt tagagggaac ggctgtttta gaaggtccta caaatgaagg tcgctggatg       180
     ataaatgcgt tgattggtca acactcgctt tttggaatgg aaagtttact cgaaactaaa       240
     acagcacctg aacttactga atatcgtgtt cgcgcattag aaaatggtac cgttctattt       300
     attgaccgcg agtttcttct caattattta tatgcaaacc cacaattttt ccatcttata       360
     cttgatgaag ttattgtcag atatttattt acatcaaaaa attacaagaa tattaatcaa       420
     gcacccatag tcaaagtaac gcgtattttg gtggaaatta ttgagttact tcatttgcat       480
     caaacagagg gggcaattga gcttccagtc tatgtcacgc aaactttctt agctgattat       540
     tgtcgttcga gtcgagctag agtaactgaa gtgttagaag agctacggga aagcggacta       600
     ctgctttcca aaaagcccat caccattagc tcgcacgaga atctactcaa tcaaatagat       660
     agttttcaaa ccggaaacgg cttattaacg agataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page