(data stored in ACNUC10821 zone)

EMBL: AE017262.PE13

AE017262.PE13        Location/Qualifiers
FT   CDS_pept        14803..15873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0013"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02803"
FT                   /protein_id="AAT02803.1"
FT                   /translation="MKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSE
FT                   RNELWIPHYENPVSWPIGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETE
FT                   LIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSCGDIA
FT                   SCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWTGTPV
FT                   STGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSSIKENRRILQE
FT                   LGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNEWEKL
FT                   GIKHLPFHTGRVQITE"
     atgaaaaata aactacaggt taaaataccc ggaaaattat atgtagctgg tgaatatgca        60
     gttgtagaat caggtcatac ggctattcta actgcagtta atcgttatat aacgctaact       120
     cttgaagata gtgaacgcaa tgaattatgg attccacatt atgaaaatcc agtttcatgg       180
     ccaattggcg gagaacttaa accagacggg gaacattgga cgtttacagc tgaagcaatt       240
     aatatcgcga caactttcct gaaatcagaa ggaatcgagc taacgcctgt gaaaatggtc       300
     attgaaacag aattaatcga ccaatctggc gcaaaatatg gactcggttc cagtgcagcg       360
     gctacagttg ctgtaatcaa cgcgctaatg acgaaatttt atccagaaat atcaatgctt       420
     aaaaaattca aacttgctgc actttcgcat ttagtagtac aaggaaatgg ctcttgtggc       480
     gacattgctt cttgtatgta tggcggctgg attgcgtata caacgtttga tcaagaatgg       540
     gtgaagcatc gtttggctta taaatcactc gaatggttta tgaaagagcc gtggccaatg       600
     cttcaaatcg aaacattgga agaaccagtg ccgacttttt ctgtcggttg gacgggcaca       660
     cctgtaagta ccggaaaact agtttcgcaa attcatgctt ttaaacaaga agatagcaag       720
     aattaccaac attttttaac tagaaataac gagattatga agcaaataat tcaagctttc       780
     catacgaaag atgaggaatt gctttattca tctattaaag aaaatcgtcg cattcttcaa       840
     gaacttggaa caaaagctgg cgtaaatatt gaaacaagct tactaaaaga actagcggac       900
     tcagctgaaa acatgggtgg cgcaggaaaa tcatctggct ctggtggcgg agactgcgga       960
     atagctttct cgaaaacgaa agaactagcc gaaaaactcg ttaatgagtg ggaaaagctt      1020
     ggtattaagc atttaccttt ccatacaggg agagttcaaa ttactgaata a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page