(data stored in ACNUC10821 zone)

EMBL: AE017262.PE130

AE017262.PE130       Location/Qualifiers
FT   CDS_pept        complement(132867..133202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0132"
FT                   /product="putative prophage LambdaLm01, repressor protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02920"
FT                   /protein_id="AAT02920.1"
FT                   /translation="MELNKFVGNKIKQYREERGLNQEALAEKLHTTRQTISRYENGDRK
FT                   ANQDVLFELAKIFNKRLDDFFPERNLPPVDERLVTIAAHIDDDVTEEEMRDILAYIEMK
FT                   KKLHRGM"
     atggagttaa ataaatttgt aggaaataaa ataaaacaat atcgcgagga acgaggctta        60
     aatcaagaag cattagcaga aaagcttcat acaactcgcc aaactattag ccgttatgaa       120
     aatggtgatc gaaaagcaaa tcaagacgtt ttatttgaac ttgcaaaaat tttcaacaaa       180
     cgattagatg acttttttcc tgaaagaaat ttaccacctg ttgatgaacg cttggtaaca       240
     attgcagccc atattgatga tgacgtaacc gaggaagaaa tgcgggatat tttagcttat       300
     atagagatga agaaaaaact ccatcgcggg atgtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page