(data stored in ACNUC10821 zone)

EMBL: AE017262.PE135

AE017262.PE135       Location/Qualifiers
FT   CDS_pept        135517..135819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0164"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02925"
FT                   /protein_id="AAT02925.1"
FT                   /translation="MFEVNDTTYILRFNKQKVKTVELTSGISLVAALTANKGILSYQVI
FT                   ETLFVSGLVEEKGLVPVKQKEALEIFDKLVEEQGLISLNVAVIEKLQEDMGFLFR"
     atgtttgaag tgaatgatac aacttatatt ttacgattta ataaacaaaa agttaaaacg        60
     gtggaattaa catcagggat tagtttagtt gcagctttga ctgcgaataa agggattttg       120
     agctaccaag tgattgaaac gctatttgtt tcaggacttg tggaagaaaa aggcttagta       180
     cctgtaaaac aaaaagaagc tttggagatt ttcgacaaat tagtagaaga acaaggctta       240
     atttcgctta atgtagctgt tattgagaaa ttgcaagagg atatgggttt tttgttccgt       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page