(data stored in ACNUC10821 zone)

EMBL: AE017262.PE136

AE017262.PE136       Location/Qualifiers
FT   CDS_pept        135861..136265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0165"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02926"
FT                   /protein_id="AAT02926.1"
FT                   /translation="MDSEMNHDFDLEKQFAFFVVNFQMSKHDFEELTEVEKNFIMKEWE
FT                   NKVIFESTMLRNAVLNAEQNLNRKRNSRFIDLHKKRQKKADVNYTVNALQAISDNEAKE
FT                   GKAWIDRIYGANGLRRPKNKEERGKVNGGF"
     gtggatagtg aaatgaacca tgattttgat ttggaaaaac aattcgcttt ttttgtagtt        60
     aattttcaga tgtccaagca tgattttgaa gaacttactg aagtggagaa aaatttcatc       120
     atgaaagaat gggaaaacaa ggtgattttt gaatctacta tgcttcgaaa tgcagtttta       180
     aatgcggaac aaaatctcaa tcgaaaacga aattcacgtt ttatcgactt gcataaaaaa       240
     cgtcagaaga aagccgatgt taattataca gtaaatgcac ttcaagcaat ttccgataat       300
     gaagcgaagg aaggtaaagc gtggattgat cggatttatg gtgcaaatgg gttacgaaga       360
     cctaagaata aagaagaaag ggggaaagtg aatggcggat tctaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page