(data stored in ACNUC10821 zone)

EMBL: AE017262.PE137

AE017262.PE137       Location/Qualifiers
FT   CDS_pept        136252..138120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0166"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02927"
FT                   /protein_id="AAT02927.1"
FT                   /translation="MADSKSFTFELNESVLTAQVGRLDEMAMVVERRFSELKMTIEDVG
FT                   NADPGSKISESLGGLQSGLGTISSAFGQLGSSSEAITSGFGTAVGSVGGITDAFKNLGS
FT                   SVQNGTLFSSLATGIGGMSTMLGGVSGGVQGITNLASGFMELKKHLGGLMSSIGGVGGI
FT                   MGKLTSPMGLVIIGIVALVAAFAYLMTTNESFRNTVMSVVTQVAQLFGQLVASLMPIIM
FT                   QIVTAVMQIGAALMPMVMQFISFFAQLLAQLMPFINMLISMLMPVIMQIVQVVMSLVSA
FT                   LLPSIMTVIQGIMSVIQFLIPIIMQIATVVVQIVVTIISYISKIMPIVMTIIGVIVSII
FT                   TTIISYVVIIATTIASVIGKIISFIASVITAVIGIVQPIIGFITNIFTTIVTIIGAAFQ
FT                   MVFTVASKIWNAIMTTISGIIEGIKAVITGISTTVSSVFNGVKRIITGVFDGIKSAWGG
FT                   LTDFVGNIFDGVSSAIQTVVDNVKGFVNVVIRGINGAIGLINKIPGVEIGKIPQLISGT
FT                   TNFQGGFARMNEGGRGEMVVLPSGSQVIPHDATMKYARESARGNKSMLYTSQGADLARV
FT                   ENLLERLLQKNPVIKMDDKVVAEVVSRNQANSFDQYNYTMGGAAYS"
     atggcggatt ctaaaagttt tacatttgaa ctgaacgaga gcgttttaac agcgcaagtt        60
     ggcaggctag atgagatggc gatggttgta gagcggcggt tttcagagct caaaatgact       120
     attgaagatg ttggaaatgc tgatccaggt tcgaaaattt ccgaatcttt aggtgggctg       180
     cagtctgggc ttggcacgat tagttcggcg tttggacaac tgggttctag tagtgaggcg       240
     attacatccg gattcggtac tgcggttggt tctgttggtg gaatcacgga tgcgtttaaa       300
     aatctaggtt caagtgtgca aaatggtacg ttattttcaa gcttggcaac cgggattggt       360
     ggcatgagta caatgcttgg tggagtatct ggcggcgttc aaggaattac aaatctagct       420
     agtggattta tggaattgaa gaagcatcta ggcggtttga tgtcatctat tggtggcgtt       480
     ggtggaatta tgggtaaact gacctctcca atggggttag taattatcgg gattgtagcg       540
     ttagtagctg catttgcgta tttgatgacg acgaatgaat cattccgaaa tacggtgatg       600
     tcagttgtaa cacaggttgc gcaactgttc ggtcaacttg tcgccagttt aatgccgatt       660
     atcatgcaaa ttgttactgc ggttatgcaa attggtgccg cgttaatgcc gatggttatg       720
     caatttatta gcttttttgc gcaattgtta gcccaattaa tgccgtttat taatatgctg       780
     atttccatgc ttatgcctgt tattatgcag attgttcaag ttgttatgtc acttgtttcg       840
     gcactattac cgagcatcat gacagtgatt caaggcatta tgagcgttat tcaattttta       900
     attccgataa tcatgcaaat tgcgacggtg gttgtacaaa ttgttgtaac gattatttct       960
     tatataagta aaattatgcc gattgttatg acgattattg gcgttattgt ttcgattatc      1020
     acaacgatta ttagttacgt cgttattatt gcgacgacga ttgctagtgt tattgggaaa      1080
     attattagct ttattgcgag tgttattacg gcggttatcg ggattgtgca accaattatt      1140
     ggctttatta ctaatatctt tacgactatc gtgacgatta ttggtgcagc tttccaaatg      1200
     gtatttactg ttgcatccaa aatctggaat gccattatga cgacgatttc cggaattatt      1260
     gaaggaatca aagcagtcat cacaggtatt tctactacgg tttcatcagt gtttaacgga      1320
     gtgaagcgca ttattacagg tgtttttgac ggaatcaaaa gtgcttgggg tggtttaact      1380
     gattttgtag gaaatatttt cgatggtgtt tcaagtgcaa ttcaaaccgt ggtagataat      1440
     gtcaaaggtt ttgtaaacgt cgtaattcga gggattaatg gagccattgg tttaattaat      1500
     aagattccag gcgttgaaat cggcaaaata ccacaattaa tttccggtac aacaaatttc      1560
     caaggtggct ttgctcgaat gaatgaaggc ggccgaggcg aaatggtggt tttaccgtcg      1620
     ggttcgcaag taattccgca cgatgcaacg atgaaatacg caagggaaag tgcgcgcgga      1680
     aataaatcaa tgctttacac gagtcaaggc gctgatttgg ctagagttga aaatcttctc      1740
     gagcgcttac tacaaaaaaa tcctgtaatc aaaatggatg acaaagtggt agccgaggta      1800
     gttagccgta accaagctaa ctcatttgat cagtacaatt acacaatggg aggtgcagct      1860
     tattcatga                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page