(data stored in ACNUC10821 zone)

EMBL: AE017262.PE138

AE017262.PE138       Location/Qualifiers
FT   CDS_pept        138117..138935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0167; match
FT                   to protein family HMM PF06997"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02928"
FT                   /protein_id="AAT02928.1"
FT                   /translation="MSDLFLELNGKVHSLSETFPGLSVQEVSRQSPQLSMETAEIAGTD
FT                   GVIPGMTQFKPFIFSAKCNLQALDIPDYHLAVREIYEFLFQRDSYYIWSDQMPGIRYEV
FT                   HPKPVDFSRESDRVGLLTIEFDVFKGYAESRGTSLDPMTFEVDLWQMGMNLSNRDDLFY
FT                   IFKENTFRVYNAGSDRVNPLMRHELDIAMTANGTPTIHNLTTGESFEYRKELQKTDVLL
FT                   LNNIYPLVNNRRVGKDTNHGIITLEKGWNDFEIKGVTDVTIAFNFPFIYR"
     atgagcgact tgtttttaga attaaatgga aaagtgcatt cgcttagtga gacatttcca        60
     ggtctttctg tacaagaagt ttccagacaa agtccccagt taagcatgga aactgctgaa       120
     atcgctggga ctgatggggt tatcccggga atgacccaat ttaaaccgtt tatcttttca       180
     gcaaaatgta atttgcaagc acttgatatt ccagattatc atttggcagt cagagaaatt       240
     tatgaatttt tattccagcg cgatagttat tatatttgga gcgatcaaat gccaggaatt       300
     cggtatgagg tgcatcctaa accagttgat tttagtcgag aatcggatcg tgttggttta       360
     ctcactatag aatttgatgt atttaaaggc tatgcggagt cacgtggcac gagccttgac       420
     cctatgactt ttgaagtgga tttatggcaa atgggaatga atttatcgaa ccgtgatgat       480
     ttattttata tttttaaaga aaatacattt cgggtctata atgcggggag cgaccgtgtt       540
     aatccactga tgcgacatga attagatatt gctatgacgg cgaatgggac accaacgatt       600
     cataatctta caacgggaga atccttcgag tatcggaaag agctacaaaa aacagatgtt       660
     ttactgttga acaatattta tccacttgtt aataaccgcc gtgttggaaa agataccaat       720
     catgggatta tcacccttga aaaaggctgg aacgattttg aaatcaaagg tgtaacggat       780
     gtaacgattg cttttaattt tccgttcatt tatcggtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page