(data stored in ACNUC10821 zone)

EMBL: AE017262.PE14

AE017262.PE14        Location/Qualifiers
FT   CDS_pept        complement(15966..16160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02804"
FT                   /protein_id="AAT02804.1"
FT                   /translation="MKRNKLKIIFRIIELVLGILIIIATSVLYFMDIISGGASGVISAV
FT                   GMGIFIHANNLSKKDNTTE"
     atgaaaagaa ataaactaaa gataatattt cgaataatag agttggtatt gggaatttta        60
     attattatcg caacatctgt attatatttt atggatatta tttctggtgg agcctctggc       120
     gttatatcag ctgttggaat gggtattttt atacacgcga ataatttatc taaaaaagat       180
     aatacgactg aataa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page