(data stored in ACNUC10821 zone)

EMBL: AE017262.PE140

AE017262.PE140       Location/Qualifiers
FT   CDS_pept        140071..140370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0169"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02930"
FT                   /protein_id="AAT02930.1"
FT                   /translation="MATEIRVLKNVDDTVFYPKTHVTAVEGLDSATTTTSGLMPASDKT
FT                   KLNGIEANAEKNNVTAIDIANWNKKQDAILVSENGSNFKITVTNAGELKATKVE"
     atggcgactg aaattagagt gttaaaaaat gtagatgata cagttttcta tccgaagaca        60
     catgtaacgg ctgtggaagg tttggactcg gctacaacta ctacatctgg attaatgccc       120
     gccagcgaca aaacgaaatt aaatggaatc gaagctaatg cagaaaaaaa taatgtgact       180
     gcaatcgata ttgccaattg gaataaaaaa caggacgcaa ttttggtttc tgaaaatggc       240
     tctaatttca aaataactgt cacaaatgct ggtgaactaa aggcaacaaa agtggaatag       300
//

If you have problems or comments...

PBIL Back to PBIL home page