(data stored in ACNUC10821 zone)

EMBL: AE017262.PE142

AE017262.PE142       Location/Qualifiers
FT   CDS_pept        140975..141454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0171"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02932"
FT                   /protein_id="AAT02932.1"
FT                   /translation="MTEIKRMLQTKEDNSKEQFYPETHVAGIVGLTEYVSGQLPTGVVS
FT                   VNGKAGRVLLDAEDVHAAKKSHNHEVATYTTDGFMSSFDKQKIDQLVSPEAGVTSINGK
FT                   TGIVDLFAADLDAAEINHTHAEATTTESGFLAKEDKEKLDAMQIIALETIKEVIE"
     atgactgaaa taaagcgaat gctgcagaca aaagaagata attcaaaaga acaattttat        60
     ccagagacgc atgttgcggg gattgttggg ttgacggaat atgtgtcagg ccagcttccg       120
     acaggcgtgg ttagtgttaa tggtaaggct gggcgcgtgt tgctagatgc agaagatgtc       180
     cacgctgcca aaaagagcca caaccacgaa gtcgcaacat acacgacgga cggctttatg       240
     agttcttttg ataaacaaaa gattgatcaa ttagtttcac cagaagctgg cgtgacaagc       300
     ataaatggca aaacagggat tgttgattta ttcgcagcgg acttagatgc agcagagata       360
     aaccacacgc atgcagaagc aactactaca gaaagtggtt ttttggcaaa agaggacaaa       420
     gaaaaactag acgcgatgca aataatcgcg ctggaaacta ttaaggaggt tatagaatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page