(data stored in ACNUC10821 zone)

EMBL: AE017262.PE144

AE017262.PE144       Location/Qualifiers
FT   CDS_pept        142006..142428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0146"
FT                   /product="putative prophage LambdaLm01, holin"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02934"
FT                   /protein_id="AAT02934.1"
FT                   /translation="MEVILKIGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDSKSGDEEEKHDKDMD"
     atggaagtca tactaaaaat tgggatttta ggttttggcg cgatatttgg atacttgttt        60
     ggggaagtgg atttattggt aaaagtgctg gtgtgcttta ttgtagctga ctatatttct       120
     gggctactcg cttcagggta tcttggggaa cttagcagca aaatgggttt caaaggaatc       180
     gcgaaaaaaa tcgctatctt aattttagtg gctattgcgc atcaaataga tttgattctt       240
     ggaacgcata atacaacgcg ggatgcggtt atctttttct atttggcgaa tgagctgatt       300
     tccatcttgg aaaattttgt tcgaatggga atgaaggtcc cggaagtatt gaaaaattta       360
     attttgattt tcgattctaa gtcaggggac gaggaggaaa agcatgacaa agatatggat       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page