(data stored in ACNUC10821 zone)

EMBL: AE017262.PE146

AE017262.PE146       Location/Qualifiers
FT   CDS_pept        complement(143175..145523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0148"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF02872; match to protein family HMM PF05738;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02936"
FT                   /protein_id="AAT02936.1"
FT                   /translation="MNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILGIN
FT                   DFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVGAS
FT                   PAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAYPR
FT                   VKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIKDY
FT                   DFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMITKANE
FT                   LDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVTPPDAK
FT                   ITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKESEL
FT                   GNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGNIL
FT                   QVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTPLK
FT                   ADQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQKEG
FT                   RKVYKSQAEIDKETEDAAIKAIKDATKINKLAEKDKTLTGTTLPGATVSVQKATANARM
FT                   ALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPPDN
FT                   GNGGTDNGNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTPNTSTTGTSANTSL
FT                   PTTGDTAGFATVFGIVLTTTALYVLRKRS"
     gtgaacaaat ttttcaagaa aactacacat gttttactcg tagcagggct cacaatcgga        60
     cttacagcac cattcaccgg gacaacagca caagcagcag cggataccgt tcccattcag       120
     attttgggaa taaatgattt ccacggagcg cttgaaacag cctctaaaga tgcatcaggc       180
     tcaccaattg gcggagcaga ttacttagct accaatttgg ataatgccac taactcattt       240
     ttacaggcaa atcctggggc gacaactgac aatgctatcc gtgttcaagc gggcgacatg       300
     gtcggcgcaa gtccagcagt atcaggttta cttcaagacg agccaacgat gaaagttctc       360
     caaaaaatga atttcgaagt cggcacatta ggtaaccatg agtttgatga aggattacca       420
     gaatacaaac gaattttgga cggagtttct acaaacaaat tcggaccaat cgtagaagct       480
     tatccacgcg ttaaaagtga catgaaaatc gtcgcagcta acgtggtcaa caaaggaaca       540
     aacacagtcg cagaaggctt tttaccatac tatgtaaaag aaattgatgg cgtcaaagtt       600
     ggcttcatcg gtatcgttac aacagaaatt cctaatttag ttcttgcaaa tcatattaaa       660
     gactacgatt tccttgacga agcagaaaca atcgttaaat actctgctga actaagaggc       720
     caaggcgtta acgcaatcgt tgttctatct cacgttcccg cactttctac tggaaatcct       780
     aacactggaa caaaacaaga tgtagctggc gaagctgcta atatgatcac aaaagcaaat       840
     gaattagacc caaataactc ggtcgattta gttcttgctg gacacaatca ccaatacaca       900
     aatggattag tcggaaaaac tcgtatcgtt caaagttaca acaatggtaa agctttttca       960
     gatgtaactg gcgaacttga taaaactacc ggcgatttcg ttacaccacc tgacgctaaa      1020
     attacataca acacgagaag cgtcacacca aatgccgata ttacagctgt tactgaagat      1080
     gcgaaaagcc gcattgaagg ggttatcaac gaaactatcg gactagccaa taaagacgtt      1140
     atttctcgtg acaccaatcc agacaacaaa gcaattgatg ataaagaatc agagcttggt      1200
     aacatgatta cagatgcgca acgttacatg gcaaataaag ccggcgccga tgtcgacttt      1260
     gctatgacta acaacggcgg aattcgttct gaccttacta ctcgtcttgc aaatggccaa      1320
     aacgaaatca catggggcgc ggcacaagct gttcaaccat ttggtaacat tcttcaagta      1380
     gtagaaatga ctggtgctga tattttggaa gctctaaacc aacaatattt aagcaaccaa      1440
     acttatttcc tacaaatttc tggattaaaa tatactttca ctgatacaga tgacttagat      1500
     catgcgtaca aagttgcaag cgttacaaca gaagacggaa ctcctttaaa agccgaccaa      1560
     aaatacaaag tcgtaatcaa tgacttccta tttggcggtg gcgatggatt ttctgccttc      1620
     aaaaaagcaa acctagtaac tgcaatcgac ccagacactg aaacattcat caactacatc      1680
     aaagaccaaa aagctgctgg aaaagtcatt acagctcaaa aagaaggacg taaagtctac      1740
     aaatcccaag ctgaaatcga caaagaaacc gaagatgcag ctatcaaagc aatcaaagac      1800
     gcaacaaaaa tcaataaact agccgaaaaa gacaaaactc taactggaac aactttgcct      1860
     ggcgcaactg tctctgttca aaaagcaact gctaacgcaa gaatggccct tgctgccgga      1920
     cctaacgcaa cagctgacgc aaatggcaag ttttccgtag atgtaacatc tttaaacctt      1980
     aaaaaaggcg accaaatcac aacaactatc actgacccga acggatacag caccactttc      2040
     caagcaacgg ttcaagctgc ggcaacaact cctccagata atggaaacgg cggcacggac      2100
     aatggtaatg gaaacggaaa taacggtggc acagatggaa atggcggaac aaataacggt      2160
     aacggctccg gcacaaacgg cggaactact actaccgaag atccgacaac tacgacacca      2220
     aacacatcaa caacaggaac ttctgctaac acatccttac caacaactgg tgatacagct      2280
     ggatttgcaa ctgtattcgg tattgtttta acgactactg cgctttatgt tttgcggaag      2340
     agaagttaa                                                              2349
//

If you have problems or comments...

PBIL Back to PBIL home page