(data stored in ACNUC10821 zone)

EMBL: AE017262.PE147

AE017262.PE147       Location/Qualifiers
FT   CDS_pept        145717..146466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0149"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02937"
FT                   /protein_id="AAT02937.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLIRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEDIKEKYSFV"
     atggatatct caagtacgga aatatgggat gcaattagga gaaatagtta tttgctatat        60
     tatcaaccaa aagtagacgc gaaaacgaat aaaattattg gctttgaagg tttgattcga       120
     ttaaaaacgg caacaaccat tttggctcca attgatttct ttgatgatat tgtcctttta       180
     aatgcaacgc gggaaatgca agattttgtt gctgaaacag cgataaaaca gattaatcag       240
     ctaggaggac gtttttcaat ttcgattaat attccggcac attatgtagc gagcagtacg       300
     tatatgactt ttttacatga ttatgtgaaa gaacatttaa agtatccgga atgcttagaa       360
     atagagatta tcgaacgagg cgaaataacg gaactagcta tagcggataa aaacttacga       420
     aaaataaaag accttggtgt caaagtaagt atggatgatt ttgggaaagg ttatagttcg       480
     cttgcgtatt tacgcagctt accgattgat attgtgaaaa cagatatgtc ctttatcgcg       540
     cttttaaaaa cagatcgaaa acaacaaatt attattcgag cgattgtcaa tttgtgtcat       600
     gatttaggcg ggaaagtagt tacagaaggc gtagaagaca tggagcaagt cgaaaaatta       660
     cgggaaatga aagtagacta tttccagggc tattatttta gtcgaccact accgatggaa       720
     gatattaaag aaaaatattc ctttgtgtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page