(data stored in ACNUC10821 zone)

EMBL: AE017262.PE148

AE017262.PE148       Location/Qualifiers
FT   CDS_pept        complement(146536..148044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0150"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02938"
FT                   /protein_id="AAT02938.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILNLKEKTGHSTVAVTEDGTAHGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
     atggcatttt attttgaaga accgtcccgc acatttagtg aatttttact tgtcccaggc        60
     tactcatccg ctgaatgtgt tccaacaaat gttagcttaa aaacaccaat cgtaaaattt       120
     aaaaaagggg aagaatctgc tatcacaatg aacattccgc ttgtttccgc aattatgcaa       180
     gctgtttctg atgataatat ggggattgcg cttgcgacag aaggtggcgt atcattcatc       240
     ttcggctccc agtccatcga aagtgaagct gcaatggttt ctcgcgtgaa aaatcataaa       300
     gctggtttcg ttattagtga ttccaacatc agccctgaca aaacacttca agacatcctt       360
     aatttaaaag aaaaaacggg tcattctaca gtagcagtta cagaagacgg cacagcgcac       420
     ggtaaattac ttggaatcgt gacaagtcgc gactaccgcg taacgcgcat gagccctgat       480
     gaaaaagtag cagatttcat gactcctttc gaaaaattag ttactgctaa caaatcgacc       540
     actttaaaag aagctaacaa cattatttgg gacaacaaat taaatgccct accacttgta       600
     gacgataacg agcacctagt ccatatggta ttccgcaaag actatgactc taataaagaa       660
     aataaattag aactacttga ttcctccaaa cgttacgttg ttggagctgg tattaacacg       720
     cgcgactacg aagaacgtgt tcccgctcta gttgaagctg gcgcagatat tctgtgtatc       780
     gattcctctg agggttactc cgaatggcaa aaacgcacac ttgactacgt tcgcggtaaa       840
     tacggcgata cggtcaaagt tggcgcaggg aatgttgttg accgcgatgg tttccgttat       900
     cttgcagaag ctggcgcaga tttcgttaaa gttggcgttg gtggtggttc catttgtatc       960
     acgcgtgaac aaaaaggtat cggacgcggg caagcaactg cactaattga tgtggctaaa      1020
     gcacgcgatg aatattttga agaaacaggt gtatatattc caatttgttc tgatggtgga      1080
     attgtttatg actaccacat gacgctagct ctagcaatgg gcgctgactt tatcatgctt      1140
     ggtcgttatt tctctcgttt tgacgaaagt cctactaata aagtgaattt aaacggcacg      1200
     tatatgaaag aatattgggg tgaaggagct aaccgcgcgc gcaactggca acgttatgac      1260
     cttggaggcg acaagaaatt atcttttgaa gaaggcgtag attcttatgt tccttacgct      1320
     ggatctttga aagacaatgt tgccatcagc cttagcaaag tacgctctac tatgtgtaac      1380
     tgcggcgcgc tcaatatccc tgaattacaa caaaaagcaa aaatcaccct tgtttcgtcc      1440
     acttctatcg tagaaggcgg cgcgcatgac gtggttgtaa aagatgcttc aaataattta      1500
     atcaaataa                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page