(data stored in ACNUC10821 zone)

EMBL: AE017262.PE150

AE017262.PE150       Location/Qualifiers
FT   CDS_pept        148456..148734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0152"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02940"
FT                   /protein_id="AAT02940.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKTEGKKIVPLCPFAKAEFAKKPEYQEVQAAK"
     atggaatata aaaacggtga aaatagaatt tatgcggtaa atgatgaagg agtcgaggtt        60
     ggtgaagtga cttttgtgcc aactggggaa gatatgttta ttattgacca tacaggcgtt       120
     gatgatgcgg ctcgaggtca gggaatagcg caagaacttg tgaaacgtgc ggtcgaaaaa       180
     gcgaaaacag aaggaaagaa aattgttccg ctttgtccgt ttgcgaaagc agaatttgct       240
     aagaagccgg aatatcaaga agtacaagct gcaaaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page