(data stored in ACNUC10821 zone)

EMBL: AE017262.PE155

AE017262.PE155       Location/Qualifiers
FT   CDS_pept        153075..153443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0184"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02945"
FT                   /protein_id="AAT02945.1"
FT                   /translation="MDAKSQQMETQLQLLKKEQSAAEDFLQDLQRQQNEQEWLAEDFAR
FT                   VHQEERESLELLREVWQGAESRSFGYYLADLQEEEKQKWHKKIQANQEEHQQKITACQN
FT                   NIYQLENQQQDLQKELLQ"
     atggatgcaa agagccagca aatggagaca caactgcaac tgctgaaaaa agaacaatcc        60
     gcggccgaag attttttgca agatttacaa cgacaacaaa atgaacaaga gtggttagca       120
     gaagattttg cacgtgtcca tcaagaagaa cgggagtcgc tggagcttct acgcgaagtt       180
     tggcaaggcg cagaatcaag aagtttcggc tactatttgg cagatctaca ggaagaagaa       240
     aaacagaagt ggcataaaaa aatccaagca aaccaagaag aacaccaaca aaaaatcacc       300
     gcttgccaaa ataacatcta ccaattagaa aatcaacaac aagatttaca aaaggagttg       360
     ttacagtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page