(data stored in ACNUC10821 zone)

EMBL: AE017262.PE156

AE017262.PE156       Location/Qualifiers
FT   CDS_pept        154753..154995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19712958"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02946"
FT                   /protein_id="AAT02946.1"
FT                   /translation="MYEKVEKIINDWDPIELFPLAPKDEYSQEINKIISIVQENHNIDM
FT                   NVLAKGIRKIFIDSFGENLIFKNNEDEIAEKILAL"
     atgtatgaaa aagtagaaaa aataataaat gattgggatc caatagagct gtttccctta        60
     gctccaaaag atgaatatag tcaagaaatc aacaaaataa ttagtattgt tcaagaaaat       120
     cataacattg atatgaatgt attagctaaa ggtataagaa aaattttcat agattcgttt       180
     ggagaaaatt taatatttaa aaataacgaa gatgaaatag ctgaaaaaat tttagcgcta       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page