(data stored in ACNUC10821 zone)

EMBL: AE017262.PE158

AE017262.PE158       Location/Qualifiers
FT   CDS_pept        155691..155927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02948"
FT                   /protein_id="AAT02948.1"
FT                   /translation="MPDWDFNNPESMKAWDLASGSYAEQVSGEVRAVVGSDLRKGNIWE
FT                   NVELPRLKNNPNVTKITTIDPKTGLEKIIFERK"
     atgccagact gggattttaa taatcctgag tcaatgaaag catgggattt ggcttctggt        60
     tcttatgcag aacaagtttc tggtgaagtt cgtgcagtag ttggttcgga tttgagaaaa       120
     ggaaatattt gggaaaatgt tgagttacct agattaaaaa ataatcctaa cgtaacgaaa       180
     ataacaacga ttgatcctaa aacaggactt gaaaaaataa tttttgaaag gaagtaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page