(data stored in ACNUC10821 zone)

EMBL: AE017262.PE164

AE017262.PE164       Location/Qualifiers
FT   CDS_pept        complement(157865..159520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0167"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02954"
FT                   /protein_id="AAT02954.1"
FT                   /translation="MHFLKKTLPIFAILTVLLVTACGNDNEKSTTKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPEISADQTKYTIKLKKN
FT                   AKWSDGSQVTADDFVYAWRRAVDPKTAPGYSALFKDSIKNATEINEGKLPVTDLGVVAT
FT                   DPTTLEITLKKPVPYFISLLSFETFFPQKESFVKKQGDKYGTDSAHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDQYWDKDNVKVNEIDVQVAKDINAGVNLYNTNEADRVPLSGDFAKQY
FT                   KDKKDFQTEKDALISYLRMNQKRDGKATPLANNSLRHALNLAVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGDHLVYNKEEALKYWKQAQKELGTDKVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTSDGNYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYFNNHMSYNSPAYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIRVEK"
     atgcattttt taaagaaaac attgcctatt tttgccattt tgacagtact tttagttaca        60
     gcttgcggaa atgacaatga aaaatctacg acaaaaactt ccccggacaa aattaaattt       120
     cttgaaacca gtgaattact gactttaaat acgacagctg aggaagactt tgctagcttc       180
     accgcgcaaa accaagtctt cgagggatta tacacacttg atcaaaaaga taactttgtt       240
     cctggggttg ctgatggaat gccagaaatc agcgctgacc aaacgaaata caccattaaa       300
     ttaaagaaaa atgcgaaatg gtccgatggt tctcaagtaa ccgctgatga tttcgtctac       360
     gcgtggcgcc gtgccgttga tccaaaaact gcacctgggt actccgcgct cttcaaagat       420
     tcgattaaaa acgccactga aatcaatgaa ggcaaactac ctgtaactga ccttggtgtc       480
     gttgcaactg acccaacaac gcttgaaatc acacttaaaa aaccagttcc ttacttcatc       540
     tcacttcttt cttttgaaac atttttccca caaaaagaaa gctttgtgaa aaaacaaggc       600
     gacaaatacg ggacagatag tgcgcacact ttatacaatg gtccttttgt tatgaaggat       660
     tggggcggca acattacgaa taaatggact tacgcgaaaa acgaccaata ttgggacaaa       720
     gataatgtca aagtaaatga aattgatgtg caagtcgcga aagatattaa cgccggcgtg       780
     aacctttata atacaaacga agctgaccgc gtgccacttt caggcgattt tgcgaaacaa       840
     tacaaagaca agaaagattt ccaaacggaa aaagatgcgc tgattagtta tttgcgcatg       900
     aatcaaaaac gcgacggtaa agcgactcca cttgcgaata attccttgcg tcacgcgctt       960
     aatttagctg tcgataagaa acaactaacg gatcggattc tcggtgacgg ttccttccca      1020
     gcgaacggac ttcttccaaa agatttcgtc caaaacccaa caacgggcgc tgatttccgc      1080
     acagatagcg gcgaccattt agtttataac aaagaagaag ctttaaaata ttggaaacaa      1140
     gcacaaaaag aacttggcac tgacaaagta acaattgaac ttctcggcga tgaccaagaa      1200
     acaacgaaaa ccattttcgc ttatttgaaa gcacagtttg aagataattt gccaggtgtg      1260
     acgattaaag tgaaaaatat gccttcgaag agcgcgacac agctaacttc tgatggtaat      1320
     tatgacttgt cactggctgc ttggatgcct gattttaaag atccgtggac gtatagcagc      1380
     ttattcttat ccgattactt taataaccat atgagttaca acagccccgc ttatgataaa      1440
     cttgtaaaat caactgatac aacacttgcg acgaagcctg aagaacgttg gaatgcgttc      1500
     gtagcttctg agaaagttct gcttgatgat gacgcggcga tcttaccact ttatcaacat      1560
     caaacagcag tgttgcaacg tacggatatt accggcgtgc agaaacatgc ttttggttcg      1620
     ccttatagtt ataagtttat tcgggtggag aagtaa                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page