(data stored in ACNUC10821 zone)

EMBL: AE017262.PE165

AE017262.PE165       Location/Qualifiers
FT   CDS_pept        159743..160684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0168"
FT                   /product="zinc ABC transporter, zinc-binding protein"
FT                   /note="identified by similarity to SP:O05703; match to
FT                   protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02955"
FT                   /protein_id="AAT02955.1"
FT                   /translation="MKKWSFLVVTVLAFVLVLAGCGASNNKVSGDKDKLKVVTTFYPMY
FT                   DFTKNVAGDNASIEMLIDAGTEPHDYEPSAKDIAKIEAADVFVYNSEDMETWVPSVLKS
FT                   LDSKKLTVIDASKGIELVEGTEEEDHDHEHEEGHHHEHDPHVWLSPVLAEQEVTNIQNG
FT                   LTKADKTNADTYKKNAETYKEKLKTLDNKFKTAFEGAKQRDFVTQHAAFQYLAKEYDLH
FT                   QVAIAGLSPDQEPSPARLAELQKYVKENNISTIYFEEVASPKVAETLANETGAKLEVLS
FT                   PIEGITDKEQKKGMDYIAYMEQNLQALQKTIK"
     atgaaaaaat ggtcattttt agttgtaaca gtgttggcgt tcgttttagt tttggccgga        60
     tgcggtgcta gcaacaataa agtaagtgga gataaggaca agctcaaggt agtgacaact       120
     ttttatccaa tgtacgattt tacgaaaaat gttgcgggag ataatgcttc cattgaaatg       180
     ttgattgatg cggggacaga accgcatgat tacgagccaa gcgcaaagga tattgccaaa       240
     atcgaagcgg ctgatgtttt cgtttataac agtgaagaca tggaaacttg ggtgccgagc       300
     gtacttaaaa gcttagattc gaaaaaatta accgtgattg acgcgagtaa aggaatcgag       360
     ctagtagaag gaaccgaaga agaagaccat gatcatgagc acgaagaagg acaccaccat       420
     gaacatgatc ctcacgtatg gctaagccca gtccttgccg aacaagaagt gactaatatc       480
     cagaacggtc ttacaaaagc agataaaaca aatgcagata catacaaaaa gaacgcagaa       540
     acatataaag agaaattaaa aacactcgac aacaaattta aaacagcttt tgaaggagca       600
     aaacaacgcg atttcgtaac ccaacatgca gccttccaat atttagcaaa agagtatgac       660
     ttgcatcaag tggcaatcgc cggcctttca cctgaccaag aaccaagccc agcacgatta       720
     gcggaattac aaaaatacgt gaaagaaaat aatatcagca ccatttattt tgaagaagta       780
     gcttcaccaa aagttgcaga aacacttgca aacgaaacgg gagcaaaact agaagtacta       840
     agccctatcg aaggaattac ggataaagaa cagaaaaaag gcatggatta tattgcttat       900
     atggaacaaa acttacaagc cttgcaaaaa acaataaaat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page