(data stored in ACNUC10821 zone)

EMBL: AE017262.PE168

AE017262.PE168       Location/Qualifiers
FT   CDS_pept        complement(162160..162840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0171"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02958"
FT                   /protein_id="AAT02958.1"
FT                   /translation="MPKNLYNYQEFIRLSHEGKIAFEQIDVPKNASLLTEKIDIDNHIY
FT                   LVVDGYIALILNDGSQNPKIYSIQGKGTFLNYFTLLDRSNNHFNFKTLSGCSLYKYSKA
FT                   DMEYFLSMFPENFGFQFFIMKNQTTHIYFKSLMASSPASEKLKTTFSNMALLHGVLSDD
FT                   DTVILPQAIKTSHLLSYSNLSKSCFYKDLQHLKTTNQIEKKEKSWIIHDQELYAMIQNG
FT                   QTSF"
     atgccaaaaa atttatataa ttatcaagaa tttattcgtt tatcccatga aggaaaaata        60
     gcttttgaac aaattgatgt accaaaaaac gccagcctat taacagaaaa aatcgatata       120
     gataaccata tttatcttgt agttgatgga tatattgctt tgattttaaa tgatggtagc       180
     caaaatccca aaatctattc tattcaaggt aaaggaacat ttttgaacta ttttacatta       240
     ctcgaccgaa gtaataatca tttcaatttt aagactctct ctggatgttc attatataag       300
     tattcgaaag cagatatgga gtattttctt tcaatgtttc ccgaaaattt cggattccaa       360
     tttttcataa tgaaaaacca gactactcac atttacttta aaagcttaat ggcaagtagt       420
     ccggcttctg aaaaacttaa aacgaccttt tcgaatatgg ctttgttaca cggggttctg       480
     agtgatgatg acacagtaat tcttcctcaa gcaattaaaa caagtcatct actttcttat       540
     agtaatcttt cgaaaagctg tttttacaaa gatttgcagc atctcaaaac aaccaatcag       600
     attgaaaaga aagaaaaaag ttggattatt catgaccaag agctttatgc aatgatacaa       660
     aatggtcaaa catcgttcta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page