(data stored in ACNUC10821 zone)

EMBL: AE017262.PE169

AE017262.PE169       Location/Qualifiers
FT   CDS_pept        163118..165457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06733"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02959"
FT                   /protein_id="AAT02959.1"
FT                   /translation="MRRVRISVRRLVEFVRRSGSIDNRMTNSDRALEGTKIHQLLQKEA
FT                   GEEYAAEVRLNLERIVDGIAFSLDGRADGIINSRMIDEIKTTETPMDEITEDFRPLHWA
FT                   QLICYGFMLAEKSDLAEVTLQLTYYQVVDKEVKQFQRVMSREELSVFVDDLLSQYAIWA
FT                   KASAAWEMKRNKTIQELTFPYDNYRSGQRELAIAVYRTISSEESLFCEAPTGIGKTMST
FT                   LFPGIKAMGEGKTDKLFYFTAKTITRQVAEDALDEMRRKGLAARSVTITAKDKICFLDE
FT                   RKCEPDHCQFARGYYDRLNEALFDMLQSEEAITRQVVEGYARKYTLCPFELSLDVALFC
FT                   DVIVCDYNYLFDPVVYLKRFFAEGPGKYTFLVDEVHNLVDRARSMYSATLKKSTVMQVK
FT                   RGLDSKKNKRLLNAINVMNKEMIVLNKKLKDLEKTTYVQKSELVDWNAAVLKFTFVAKE
FT                   WLPQNTQSELQVDVLDLYFESLRYTAIAEFYDERYVTQVTRNHRDLEIKQLCLDPAFLL
FT                   SERLKLGSSSVLFSATLRPIDYYTNVLGGQEDTSRMIFSSPFKQKNMHLLVADYISTKY
FT                   QMRENSMEAVVDALYALVSGKNGNYIFFFPSFLYLQKVYDLFKEKYPNIRLQKQETAMD
FT                   EKQREHFLEDFHAENVETLIGFCVLGGVFSEGVDLRGNRLVGAAVVGVGLAQLNHESDL
FT                   IKDYYNETIGQGFDYAYQIPGMNKVLQAVGRVIRGESDRGVVLLIEERFSADRYRALFP
FT                   THWNHAKTVKSTDDISREVAGFWRNS"
     atgaggagag tgcgtatttc agttaggcgt ttagtagagt ttgtgcggag aagcggtagt        60
     attgataacc ggatgacaaa ttcagaccgc gccttagaag gaacaaaaat tcatcaatta       120
     ctccaaaaag aagctgggga agaatatgcc gcagaagtac ggctaaacct agaacgaata       180
     gtggacggaa ttgctttttc gcttgatgga cgcgcagatg gcatcataaa tagtcggatg       240
     attgatgaaa ttaaaacaac agagacgcca atggatgaaa ttaccgaaga ttttcgacct       300
     cttcactggg cgcaacttat ttgttatgga tttatgcttg cagaaaagtc cgatttggca       360
     gaagttactc tgcaattaac gtattatcaa gtagttgaca aagaagtaaa acaatttcaa       420
     cgtgtaatga gtcgcgagga actgagtgtt tttgtggacg atttactttc ccaatatgct       480
     atttgggcaa aggcatctgc cgcttgggaa atgaaacgaa ataaaacaat tcaagaatta       540
     acgtttccat acgacaacta tcgaagtggg caaagagagc tcgccattgc ggtgtaccga       600
     acaatatctt cagaagaaag tttgttttgt gaagcaccca caggtatcgg caaaacaatg       660
     tcgaccttgt ttcccggtat taaagctatg ggtgaaggga aaacggataa attattttac       720
     tttactgcaa aaacaatcac gcgacaagtt gccgaagatg cactagatga gatgcgtcgt       780
     aaaggactgg ctgcaaggag tgttacaata actgcgaagg ataagatatg ttttttagac       840
     gagcggaaat gtgaaccaga tcattgccaa tttgcgcgtg gttattatga tcgtttgaac       900
     gaagcgttgt ttgatatgtt gcaatccgaa gaagcgatta cccgtcaagt tgttgagggt       960
     tatgcccgaa aatacacact ttgtccattt gaattatcgc tggatgtggc tcttttttgt      1020
     gatgtaatag tttgtgatta taattattta ttcgacccag tagtttactt aaaacgcttt      1080
     tttgcagaag gaccgggaaa atatactttt cttgtagatg aagtgcataa tttagtagac      1140
     cgtgcgcgct cgatgtattc ggcgacatta aaaaaatcaa cagttatgca agtcaaacgg      1200
     ggactagatt caaaaaagaa caaacgattg ctaaatgcaa taaatgtgat gaataaagaa      1260
     atgattgtgc ttaacaaaaa actaaaggac ttagaaaaaa cgacttatgt ccaaaaaagt      1320
     gaactcgttg attggaatgc agctgtgtta aaattcacct ttgtagcgaa ggaatggttg      1380
     ccgcaaaata ctcagtcaga attacaagtg gatgtgttgg acctttattt tgaaagttta      1440
     agatatactg ccattgcgga gttttatgat gagcgttacg tcacacaagt tacgagaaat      1500
     cacagggatt tagaaataaa acaactatgt ttggatccgg cgttcttatt atcagagagg      1560
     ctaaaactcg gaagcagttc ggtgcttttt tcagcaacgc ttcgaccaat agattactat      1620
     acaaatgtac ttggtggtca agaagacact agtagaatga tcttttcttc gccatttaaa      1680
     caaaaaaaca tgcatttact agtagcggat tatattagta cgaaatacca aatgcgtgaa      1740
     aatagtatgg aagctgtcgt agatgctctc tatgctctcg tctctgggaa aaacggcaac      1800
     tatatatttt tctttccatc atttctatat ttacaaaagg tatatgattt atttaaagaa      1860
     aaatatccta acatcaggtt gcaaaaacaa gagactgcta tggatgaaaa gcagcgagag      1920
     cattttttag aagattttca tgcagagaat gtagaaacct tgattggctt ttgcgtttta      1980
     ggaggcgttt tttcagaagg ggtagatctt cgcgggaacc gattagtcgg tgcggctgtc      2040
     gttggtgtag gacttgcgca attgaatcac gaatctgatt taattaaaga ttattataat      2100
     gaaacgattg gtcagggatt tgattatgca tatcagatac caggaatgaa taaggtgctt      2160
     caagcagttg gccgggttat tcgaggagaa tcagatcgtg gcgtagtgtt gttaatagaa      2220
     gaacgatttt ctgccgatcg ttaccgagcg ttgttcccta cgcactggaa tcatgcgaaa      2280
     acagtgaaga gcacagacga tatctcccga gaagtggccg gattttggcg gaatagctaa      2340
//

If you have problems or comments...

PBIL Back to PBIL home page