(data stored in ACNUC10821 zone)

EMBL: AE017262.PE170

AE017262.PE170       Location/Qualifiers
FT   CDS_pept        165502..166314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0173"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02960"
FT                   /protein_id="AAT02960.1"
FT                   /translation="MYKIIAIDIDGTLLNDAHEITLAVRDSIKAAKAKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDEGDYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKIT
FT                   DVIKKLPESIKEKFYVVRSVPYNLEFLQKGVNKGSALASLAEKLGVSQSEVMSIGDQEN
FT                   DITMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLILDR"
     atgtataaaa ttatcgcgat agatattgat ggcactttat taaacgacgc acacgaaatc        60
     acactagccg tgcgtgactc tattaaagct gcgaaagcaa aaggggtaaa agtagtatta       120
     tgtacaggcc gtccacttgc aggaattaaa aaaagcttaa ttgaactaga tcttttagat       180
     gaaggggatt acgcaattac gtttaatggg gcggtcgtgt tagaaacagc ttcagaaaaa       240
     acattagcag atataacctt aaataaaact gaactagaag aaatttatgc attttgtcat       300
     gcggaaaatg ttaacgtcac ttattttgat gggaaaaaca tgtatgtacc aagccgaaaa       360
     atcacagaaa tcacttgtca agattccctg ctacttggta cgccactata tcatttacct       420
     gtagaagaag cgcctgaatc tattcatgtt tccaaggtta tgctattaga ctcacctgaa       480
     aaaattaccg atgttataaa aaaattacca gagagtatca aagaaaaatt ttacgttgtc       540
     cggagtgttc cttataacct agagttcttg caaaaaggcg taaataaagg atcagcgctc       600
     gctagtttag cagaaaaact tggggtgtct caaagtgaag tcatgagtat tggtgaccaa       660
     gaaaatgata ttaccatgat tgagtatgct ggtatgggag ttgcaatggg taatgcgaca       720
     gagcatatta aagaaatcgc taactataca acaactacta ataatgaaga tggtgtggca       780
     caggctatac aaatgctcat tctggaccgc taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page