(data stored in ACNUC10821 zone)

EMBL: AE017262.PE176

AE017262.PE176       Location/Qualifiers
FT   CDS_pept        173540..173929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:10172658; match to
FT                   protein family HMM PF06156"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02966"
FT                   /db_xref="GOA:Q724P5"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724P5"
FT                   /protein_id="AAT02966.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAEIEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
     ttggataaaa aagctatttt tgactcagtc agtaatatgg aggagcaaat tggcgaattg        60
     tatcagcaac ttggagatct aaagacaaac ttaggcgaaa tgttggaaga aaataaccga       120
     ttaaaccttg aaaacgaaca tttgcgacgc agactttctt tgacggatga agcgacacca       180
     gaacctaaag ccgaaataga ggcggaacac ggtgtgatgg cgcctaatcg taaggaagca       240
     atgcagcaaa tgattgaact tggggaaggt tatgacaatc ttgtccaact ttacaaggaa       300
     ggatttcatg tttgcaatgt acatttcggc agcccgcgtg gtaatgatga agattgttta       360
     ttttgcttat ccttgctcaa taaaaaataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page