(data stored in ACNUC10821 zone)

EMBL: AE017262.PE177

AE017262.PE177       Location/Qualifiers
FT   CDS_pept        173978..174739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02967"
FT                   /protein_id="AAT02967.1"
FT                   /translation="MNHLEKLELIGDERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFS
FT                   YLPIRKGKIIDLCSGNGIIPLLLSTRTKAKIVGVEIQERLADMAKRSVAYNQLEDQIEI
FT                   IEYDLKKITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDTIRVA
FT                   ASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLVEGIKDGK
FT                   PGVKYVPPVIVYDELGEYTPVIKEILYGESE"
     gtgaatcatt tggaaaaact cgaattaatt ggtgatgaaa gactagatta tttactagca        60
     gaaaatttgc ggattattca aagcccatcg gtattttctt tctcgataga cgcggttctc       120
     ctcgctaaat ttagttattt accaatccgt aaagggaaaa taattgattt gtgtagcgga       180
     aatgggatta ttcctttact acttagtacg cgaacaaaag cgaaaatagt tggtgttgaa       240
     attcaagaac gtctggcaga tatggcgaaa agaagtgttg cttataatca actggaagac       300
     caaatcgaaa taatcgaata tgatttgaaa aaaattacag atcttattcc aaaagagcgc       360
     gcggacattg ttacctgtaa tccaccttat tttgcaaccc cggatacaag tttgaaaaat       420
     accaatgaac attttcggat tgctcgccat gaagttatgt gtacgctaga ggatactatt       480
     cgtgtagccg caagcctttt aaaacaaggt ggaaaagcga attttgttca tcgtccggaa       540
     cgattactag acatcattga tataatgaga aaatatcgct tggaaccgaa acgcattcaa       600
     ttcgtgcacc cgcgctcaga tagagaagcg aatacggtac ttgtagaagg aatcaaagac       660
     gggaaacctg gcgtgaaata tgttccacct gttatcgtat atgatgagct aggggaatat       720
     acaccagtaa ttaaggagat tttatatggc gaaagcgagt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page