(data stored in ACNUC10821 zone)

EMBL: AE017262.PE178

AE017262.PE178       Location/Qualifiers
FT   CDS_pept        174723..174992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF2693; match to
FT                   protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02968"
FT                   /db_xref="GOA:Q724P3"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724P3"
FT                   /protein_id="AAT02968.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVIRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLIQREESE"
     atggcgaaag cgagtgaaca tttcttttat gtgctaaaat gtagtgacaa ttcctattat        60
     ggtggctata caacagatgt tattcgccga gaagcggaac ataatgcggg aattagatgt       120
     aaatatacaa aaacacgtcg cccggtaaaa gtcattcatt ttgaaaaatt cgaaacaaga       180
     agtgaagcta caaaagcaga agctgcgttc aaaaaattat cacgtaaaaa taaagacgcc       240
     tatttaatac aacgggagga gtccgaatga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page