(data stored in ACNUC10821 zone)

EMBL: AE017262.PE179

AE017262.PE179       Location/Qualifiers
FT   CDS_pept        174989..175870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0182"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by similarity to GP:16412629; match to
FT                   protein family HMM PF00590; match to protein family HMM
FT                   TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02969"
FT                   /protein_id="AAT02969.1"
FT                   /translation="MIKSQKSFSGASQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPG
FT                   YELVQSALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
     atgataaaaa gtcaaaagag tttcagtgga gccagccaag gagcattata tttagtgcca        60
     acgccgattg gtaatttaga agatatgact tttcgtgcaa ttcgcatgct taaagaagcg       120
     gatattattg cagcggaaga tacgcggaac accgtgaaac ttttaaatca ttttgaaatt       180
     acaacccgaa tgacgagcta ccatcagttt acgaaggaaa ataaagaaga taatattatt       240
     cagcggatgt tagacggtga agtggtggcg cttgttagtg atgcggggat gccatctatt       300
     tctgacccgg gatacgaact tgttcaaagt gcgctaaatg ctaatattcc tgtcatccct       360
     ctaccaggag ccaatgctgc attaactgca ctgattgcat ctggtcttgc cccgcagccg       420
     ttttactttt acggatttct tccacgccaa aacaaagaac gtactcaagc gattgaaaaa       480
     ttagcggcgc gcgaagaaac gtggatttta tatgaatcac cacatcgttt aaaagaaaca       540
     ctaaaagcaa tcatcaaaat cactggaaat gatcggaaaa ttgtcttgtg tcgagagctc       600
     acaaaaagat ttgaagaatt tttacgtgga acggttgaag atgcgttaaa ctgggcaatg       660
     gacgaagaag ttcgcggaga attttgcttg attattgaag gaaatgccaa tccaccgctt       720
     gcagaagagc aactctggtg gcaagaactc gatattaaaa cgcacgtaag caccgtaatg       780
     gaacaggaaa atgttagttc taaagatgca attaaaacgg ttatgaaagc gagaaattta       840
     ccaaaacgag aagtttactc tgcttatcat gaaataaaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page