(data stored in ACNUC10821 zone)

EMBL: AE017262.PE180

AE017262.PE180       Location/Qualifiers
FT   CDS_pept        complement(175915..176199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0183"
FT                   /product="transition state regulatory protein AbrB"
FT                   /note="identified by similarity to SP:P08874; match to
FT                   protein family HMM PF04014; match to protein family HMM
FT                   TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02970"
FT                   /protein_id="AAT02970.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIVL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAELMEEIKRRFGDTL"
     atgaaatcaa ctggaatggt aagaaaaatc gacgaacttg gtcgtgtggt tataccgatt        60
     gaaataagaa gaacgatgaa cctaaatgta aaagaccctt tagaaatatt tacagatgaa       120
     gatgcgattg tattgaaaaa gtattccgct ggcttggttt gtgacgttac cggagaattt       180
     tctgttgata acaagaaatt tgtggacggt aaattgacac tcagtaaaga aggcgctgcg       240
     gaattaatgg aagaaattaa acgccgcttt ggtgatacat tataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page