(data stored in ACNUC10821 zone)

EMBL: AE017262.PE181

AE017262.PE181       Location/Qualifiers
FT   CDS_pept        176313..177170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0184"
FT                   /product="glucose uptake protein"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02971"
FT                   /protein_id="AAT02971.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTTTIIIASFISGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
     atgaacatag ttatcgcatt aattccggca gtgatgtggg ggattatgcc attagttgtt        60
     tcaaaaattg gcggtaaacc gaggcagcaa atcattggta caacattcgg cgcactagct       120
     ttcgcaatcg gagtttttat ttttacaaat ccagaatata caacaaccat tattattgct       180
     agttttattt caggggcatt ttggagctta ggtcaaatga atcagttccg ggcatttaca       240
     caagtaggcg tatcaaaaac aatgccactt tcgacaggaa tgcagttagt aggtacatcg       300
     ctttttggtg tatttgcttt tcatgaatgg ggtacaactt ccaaattagt attaggattt       360
     tccgcattag cattaattat tatcgggatt ttcttaacaa gttatcaaca acataaagac       420
     gaaaattccg gccaaaatat gaaaaaagga attatcactt tacttatttc atccgtaggt       480
     tatgtaggat atgtcgttat cactcgttgg tttgatatta gtgggtggga cgcgatttta       540
     cctcaagcaa ttgggatggt agtcgcagga ttattatttt ctattaagtc tgaagaaaaa       600
     cgttttacaa agcaaacctg gttaaatatg attccagggg tgatgtgggc tactggtaac       660
     ttggctctac tattctcaaa taaattagtt ggaatcgcta caggtttttc gctctcacaa       720
     atgggtgttg tcatttcgac cattggtgga atccttttcc taggagagaa gaaaaccaag       780
     aaagaactta ttctggtcat tatcggggtt gtcttagtaa ttatcggtgg tacgatgatt       840
     ggaattgcaa aaagctaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page