(data stored in ACNUC10821 zone)

EMBL: AE017262.PE182

AE017262.PE182       Location/Qualifiers
FT   CDS_pept        177238..178500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0211; match
FT                   to protein family HMM PF06742; match to protein family HMM
FT                   PF06863"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02972"
FT                   /protein_id="AAT02972.1"
FT                   /translation="MNANLEVNAEVVKESYVYLLSRYLVLRQENFDTKEDKIPYNTLKH
FT                   NSISPADANFVNPNFDVVYSEAWIAVDDENAVILEVPEIKNRYYTVQLLDGWGEVVTNI
FT                   NERNYPEHPHGKFAFVKKGTNPSVPSDAVKIELPSEKVKVLLRVEQKDDPEGAVKLQKA
FT                   FKFDAPDNIKIKEPLEIPHFTNAEFLLEEIYSNLEELLATYPDKMPRATEFQDKARQVA
FT                   AYIELGDEQKAEVRNLIVKEAIPYFTNGAKGFGTQKGGWSVTYVAGAFENDILARAIIN
FT                   YGGIWANSIQEALYFIGQKGTDNELLTGDKVYKIHFPADELPSELADAFWSVTLYSVPD
FT                   YHVIPNKLNKFRINNYSGPKLSEDGSLTLYIASEKPADVDPGNWLPSKAGKEFSLNFRL
FT                   YVPKKEVLEGKVFLPPLEVIK"
     atgaatgcga atttagaagt aaatgctgag gttgtaaaag aatcctatgt ttatttatta        60
     tcgcgatatc tcgttttacg ccaagaaaat tttgatacaa aagaagataa aattccatat       120
     aacacactta agcacaattc gatttcacca gcagatgcaa attttgtaaa tccgaacttt       180
     gatgtggttt attcagaagc ttggatagct gtagatgacg aaaatgccgt tattttagaa       240
     gtaccagaaa ttaaaaatcg ctactatact gtgcaacttt tagacggctg gggcgaagtg       300
     gtaacaaata tcaatgaacg taactatcca gagcatccac atggaaaatt tgctttcgtt       360
     aaaaaaggaa caaatccttc cgttccaagt gacgctgtaa aaatcgaatt accatcagag       420
     aaagtaaaag tacttcttcg cgtagaacaa aaagacgatc ctgaaggtgc agtaaaactt       480
     caaaaagcat tcaaattcga tgcaccagat aatataaaaa tcaaagaacc acttgagatt       540
     ccacatttca ctaatgcaga gttcttatta gaagaaattt attccaattt ggaagaacta       600
     ctagcaactt atccagataa aatgccaaga gcaactgaat tccaagataa agcaagacaa       660
     gtggcagcct atatcgagct tggtgatgag caaaaagctg aagtaagaaa cttaattgtg       720
     aaagaagcca ttccatattt tacaaatggt gcaaaaggat ttggtacaca aaaaggcgga       780
     tggtctgtta cttacgtagc tggcgcgttc gaaaatgata ttttagcgcg agcaatcatt       840
     aattacggcg gtatttgggc gaattctatt caagaagcac tatacttcat cggtcaaaaa       900
     ggtacggata atgagttatt aactggcgat aaagtttata aaatccattt tccggcagat       960
     gaacttccat cagaactggc agatgctttt tggtccgtta ccttatacag tgttccagat      1020
     taccacgtta tcccaaataa attaaacaaa ttccgcatca ataattactc aggtccaaaa      1080
     ctaagtgaag atggcagctt gacgctctac attgcgtcag aaaaaccagc tgatgtagat      1140
     ccgggaaact ggctaccaag caaggctgga aaagagtttt cactaaattt ccgactatat      1200
     gttccgaaaa aagaagtgtt ggaagggaaa gtattcttac caccgctgga agttataaaa      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page