(data stored in ACNUC10821 zone)

EMBL: AE017262.PE184

AE017262.PE184       Location/Qualifiers
FT   CDS_pept        180191..181051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0187"
FT                   /product="glucose uptake protein"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02974"
FT                   /protein_id="AAT02974.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAVGMVLSALIMTHSGGTEKRFNKRTLLLTIPGIIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIVLLKEKKTQKEMFFVIVGVVLVVLGGILIG
FT                   VAKGA"
     ttgaacatta tgattgcgct gattcctgca ttactctggg gaacagtacc gctaattatt        60
     acaaaatttg gcggttcaac aagacaacaa acgatgggaa tgacactagg ggcactcact       120
     tttgcggtaa tcgttttctt ctttactgac ccagtttata cgcttaaaac agtaggaatt       180
     agttttataa cagggtgttt atggactgtg ggtcaaatgt tccaactgca agcattcaaa       240
     attatcggtg tttcaaaagc aatgccgatt tctacaggga tgcaattagt cggaacaaca       300
     ctttgtgggg taatcttatt tcatgaatgg gatacgacac ttcggattat tttaggtttt       360
     attgcacttg cactaattgt tggcgggatt ttcttaacat cctatgctga aaaagaagaa       420
     gatggaacta acgcattaaa acaaggttta atcacattat tcatatctgc ttgtggttat       480
     gttggcttag tcgttctaat tcaaggtttc aaaatcgatg gaattaacgc gatcttgccg       540
     caagcggttg ggatggtttt aagtgcgcta attatgacgc atagcggtgg tacggaaaaa       600
     cgtttcaata aacgaacact cttacttact attccaggga taatctgggc ggctgggaac       660
     gttgcgatgg ttcacgctaa ccaacttgtt ggcgttgcga ctggtttttc actttcgcaa       720
     ctcggagttg ttatctcaac tattggcgga atcgtacttt taaaagaaaa gaaaacacaa       780
     aaagaaatgt tttttgttat tgtgggcgta gttttagtcg ttctcggcgg gattttaatc       840
     ggcgttgcaa aaggtgctta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page