(data stored in ACNUC10821 zone)

EMBL: AE017262.PE186

AE017262.PE186       Location/Qualifiers
FT   CDS_pept        183281..184495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0189"
FT                   /product="xylose repressor protein"
FT                   /note="identified by similarity to SP:P16557; match to
FT                   protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02976"
FT                   /protein_id="AAT02976.1"
FT                   /translation="MDILRKGNKDLIKDINRYTVLNLIREKGEITRTEIAKKCDFGMST
FT                   LTYILDDLQQEGIILEGAETSSTGGRRAKLVRFNKDYGFVVSVKVEEEQLLFALTDLNA
FT                   EIMENTSIPFSSEKKPEEAIELIAKNVKKMCENRDMNHLLGVGIAISGLVNRRKGTVIR
FT                   STMLGWENVALEAMLHAYFPDIPVYVDKNINCYTLAELWLGEGKQSNNFATVSVGAGLG
FT                   LSVVINRQIYYGAQGGAGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKEA
FT                   YPTSELKDFHFDKVAKSARAGDEMATELMGKMGEYLGYGIRNIINTFNPEKVIIVGEGL
FT                   HHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQGAALLVIHQLFQVPIYEEE
FT                   QTLLR"
     atggatatct taagaaaagg gaataaagac ttaattaaag acataaaccg ctacaccgtg        60
     ctgaatttaa tccgtgaaaa aggagaaatc acgcggactg agatagccaa aaaatgcgat       120
     tttgggatgt ctacattaac gtatatttta gatgatttac agcaagaagg cattattttg       180
     gaaggtgccg aaacatcatc tactggaggc agacgtgcca agttagttag atttaataaa       240
     gattatggat ttgttgttag tgtcaaagtt gaagaggaac aacttctttt tgcgttgacc       300
     gatttaaatg cagaaatcat ggaaaatact tctataccat tttcctcaga gaaaaaacca       360
     gaagaagcga ttgagttaat tgctaaaaat gtgaaaaaga tgtgtgaaaa cagagatatg       420
     aaccatttgc taggagttgg aattgcgatt tccggcctag ttaatcgtag aaaaggaaca       480
     gttatccgct ctactatgtt agggtgggaa aatgtcgctt tagaagcaat gctacatgct       540
     tacttcccag atattccagt gtacgtagat aaaaatataa actgctacac actcgcggaa       600
     ctatggttag gtgaaggaaa acaatcaaat aattttgcaa cagtttccgt tggagctgga       660
     cttggtttat ccgttgttat taatcgtcaa atttattatg gtgcacaggg tggagccggt       720
     gaatttggac atacaacgat tcaaccgggc ggatacaaat gtcactgtgg tcaaaaagga       780
     tgcttagaaa tgtacgcatc cgaattttat ttccgaaatc gtggcgaaga attaaaagaa       840
     gcttatccaa catcagaatt aaaggatttt cattttgata aagtagcaaa aagtgctcga       900
     gctggagacg aaatggcgac ggaacttatg ggtaaaatgg gtgaatattt aggatacggg       960
     attcgaaata ttattaatac cttcaatccg gaaaaagtta tcattgtcgg tgaaggcttg      1020
     caccatagag acttattctt aactaaaatt gatgaaattg cttcacaaaa ctttttttca      1080
     ggggctggct ttgaaacgga aattactaca acttctttag aggatcctgc atggttacaa      1140
     ggtgcggctt tactagtcat tcaccaatta ttccaagtgc caatctatga agaagaacaa      1200
     acgttactac gttaa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page