(data stored in ACNUC10821 zone)

EMBL: AE017262.PE187

AE017262.PE187       Location/Qualifiers
FT   CDS_pept        184531..185409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0190"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02977"
FT                   /protein_id="AAT02977.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFENYKRLFNDPEFWKSFRNTITFIIGYLPSVMILGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPSYGLINYFLSLIGIAGPNWLTDPQTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
     atggttggta tgactagaaa gaaaacactc ttttggctat gcatattctt gctacccaat        60
     ttactaggtt ttctcatttt tattgcaatc ccaatccttg gctcgcttgg tattagtttt       120
     accgattggg acttagtgag tactattcac tttactggat ttgaaaatta caaaaggcta       180
     tttaatgacc cagagttttg gaaatcgttt agaaatacaa tcacgttcat catcggttat       240
     ttgcctagtg taatgattct tggcctagcg tgtgccttga tgttgaacca aaaaatcaaa       300
     ctaagaccat ttttccgagc agtgtacttc ttacccgtaa tcacttcatg ggtagctgtt       360
     tcactcgttt ggaaatggct gttcaatcct tcatacggtt tgatcaatta cttcttatct       420
     ttaattggta ttgcagggcc caactggtta acagatccac aaacggcgat gattgcagtt       480
     attattacta gtgcgtggaa agatattggt ttcgttatgg tactattcct tggtggattg       540
     caaaatattt caccatcgta ttacgaagct gccaatatgg acggagcatc aaaacttcgc       600
     caattattct ctattactat cccgcttctt actcctacta cattctttgt gacgataatt       660
     tcgcttatca actcattcca ggtgtttgac caagtgatga ttatgacaga aggtggtcca       720
     agtggagcga caatgaccct agtccaaaat atttacaacc atgcatttag atacttcgaa       780
     atgggctatg cttccgcgat gagttggata ttgtttattg ttattttcat cattacaatt       840
     attcaaaata aacttcaaaa aaggtggtcc aattactaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page