(data stored in ACNUC10821 zone)

EMBL: AE017262.PE189

AE017262.PE189       Location/Qualifiers
FT   CDS_pept        186285..187541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0192"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02979"
FT                   /protein_id="AAT02979.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTKTTIN
FT                   SPENVAALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
     atgaaaaaag gtttattatt gttaatggta gttgtactgt ctgtatttgg tctttcggct        60
     tgcggcggtg gcagtagtag tggcgataaa acagaaataa cgtattatca attctctgca       120
     ccagctgatg gaaaagcact tgatgaaatg gtaaaagaat ttgaaaagca aaacccggat       180
     attaaagtga acgttcaaac aatcgcattt aacgactatt tcactaaact acaaacacaa       240
     atcgcaggtg gagatgctcc ggatgccttt gaacttaact acgaaacatt catgcaatat       300
     gctgaaaaag gtgtacttgc agatttaaca agctatatcg aaaaagataa agattttgat       360
     ccatctacac ttaacaaaca agcctacgat gctttcaaat atgatggcaa acaatacggt       420
     atggtagaaa gtttctccaa cgttgtaaca atttacaata aagacctttt tgataaagcc       480
     ggcgttgaat atccgacagc tgactggact tggaaagacg aagaagcggc agcaaaaaaa       540
     ttaacagatg ctaaaaataa agtttgggga acttcccaac cagtaacaat gaacgaattc       600
     tacaaagtag cagcgcaaaa tggtggttcg attttcaacg aagacttaac gaaaacaact       660
     atcaacagtc ctgaaaatgt ggcagcatta actcacttaa caaatgaagt aacagattca       720
     aaagtggcgc cttcaccagc tgatttatct ggccaattac cagaagattt atttatgaat       780
     ggtcaaatcg caatgcttca caccggtatt tggttgttcg atatgttcca agatgctccg       840
     ttcaaatggg atgtacaagt agaagcagga aacacgcaaa aagcaactca cttcttcgca       900
     aacggcattg gtgtttctaa agactccgat aaaaaagaag cagctttcaa attcgcttcc       960
     ttcatgagcg cgaacgaaga agcagcgaaa atcagaattg ataataactg ggaacttcca      1020
     gcgactgaaa acaaagagat tttacaacca tatttagatg caactcctcc agataacaga      1080
     gaagcagtat tcgaatctct acaatatatg gtattacctc cagttgtaaa agattggaac      1140
     aaaatcagtg attatacaaa ctctgaattc gaaaaagtat taaatggcga ttctactcca      1200
     gaaaaagcac tgaaaaacag cgaagacaac atcaacaaaa caatgggatt taaataa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page