(data stored in ACNUC10821 zone)

EMBL: AE017262.PE190

AE017262.PE190       Location/Qualifiers
FT   CDS_pept        187624..190926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0193"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02980"
FT                   /protein_id="AAT02980.1"
FT                   /translation="MSKFTKLMQGYLHLIEGKNEKIKPILLETKPNFTTDSVLETASWL
FT                   WLSSKINHYDREEVEPVIAFLVENWNRPEKSIWGSAENDIYLATISSVYSALLDVKNTF
FT                   PKPELQQTITIIRDYCFDNLLKGDSILTGFNTRKVSTDQLLSVLPFGLFSPEDLVMVAA
FT                   VGKMEQQLVQDDGVLPYSGAPRVNSFATALMALYFLEKSDQDKALHYLNMAMKMEDNDE
FT                   LGAIFIEINQAFRAMESEVTAHISHDPFGHENRYEQQLTERTPHYPETEMHFSAACEVI
FT                   SEVEPIQVELVLKEKDWTILCEKKEKNDVQIWEALVPPLEEVGEYTYYFRATMKDQTTL
FT                   TSDDYTVEPIWKHWSEEAAVCETEQGLMVLFKENPSSIIPVEFTAKSDELVIGLKPSFE
FT                   ASNVKTKSSGQLKKDDLEIIVSNNPVRLEVHFKGNLILESHKIYPALQWYTDKTGAINK
FT                   VKLHLDAPKEEEYYGFGERYNALGQRGNVLDCFVYNQYRDQGTRTYIPMPFYHTNRDYS
FT                   VFVDTARYTSFDLGNQLADKHTITVEINGCDTDICLLMGDIRSAVANYMKKTGKPAMVP
FT                   VWALGPWMSSNNWDRESVVRTEVETTQELQIPSTVVVLEQWSDEATYYMFNDAEYDEKA
FT                   PSEAYNYDEIRFPSWGRWPDPKGMVDYIHDNKMKLILWQIPIQKYLNRQQHPLKDREEA
FT                   YMIEKGYVVKNPDGSPYRIPENWFTESLIMDFSNEEGKKWWFDKRQYLIDIGVDGFKTD
FT                   GGEFVFGEGLQFADGRRGDEMRNLYPNDYVEAYYQFAQQNDGMTFSRAGYTGAQNFPAH
FT                   WAGDERSTFDAFRRSLIAGLSAGFSGIPFWSFDFAGFNGDIPTAELFIRSAEMATFCPI
FT                   MQYHAESKAEFNQDRTPWNIASRTGDDSVIPIYRHFANVRMNILPYIYNESLKCVETGL
FT                   PMMRALLLDYKEDPRVSDMYDQYLFGEAMLIAPVIEDGVRSREVYLPEGTWYDFWNGTK
FT                   VNGPTLRKCKADKEEIPVFIRGGKAVLCNVDATLKLGSWVGNTVEEYDTPLLKIYVDGD
FT                   FTEEMTDHLSEKWLVKVTENADEVVVSVQTNTPAYEVEVIGTTKKVQIKKGR"
     atgtctaaat tcacaaaatt aatgcagggt tacttgcatt taatagaagg aaaaaacgaa        60
     aaaatcaaac caatcctgct ggaaacaaaa cctaacttta caactgattc agtccttgaa       120
     accgcttctt ggctatggct tagcagtaaa atcaatcatt atgatagaga agaagtagag       180
     ccagtaattg catttttagt tgaaaactgg aatcgtcctg aaaagtctat ttggggttca       240
     gctgaaaatg atatttattt agcaactatt tcaagtgtat actctgcatt attagatgtg       300
     aaaaacactt ttccaaaacc ggagttacaa caaacgatta caattatccg cgactattgt       360
     tttgataatt tattaaaagg cgatagcatt cttactggtt ttaacacgcg gaaagtgtca       420
     accgaccagc ttttatccgt gcttccgttt ggtctatttt cgcctgaaga tcttgtaatg       480
     gtggcggctg ttggcaaaat ggaacaacaa ttagtgcaag atgatggggt attgccttat       540
     tcaggagcac caagagttaa ttcctttgca acggctctaa tggcgctata tttcttagaa       600
     aaaagtgacc aagataaagc tttacactat ttgaatatgg caatgaagat ggaagataat       660
     gacgaacttg gcgcgatttt tattgaaatt aaccaagcat tccgggcgat ggaaagtgaa       720
     gtgacagcgc atatttcaca cgatcctttt gggcatgaaa atcgctatga gcaacagtta       780
     actgaacgca cgccacatta tcccgaaaca gaaatgcatt tttcggctgc gtgtgaagtt       840
     atttctgaag tcgaaccaat ccaagtcgaa ctcgtcttaa aagagaaaga ctggaccatt       900
     ctatgtgaga agaaagaaaa aaatgatgtc caaatctggg aagcgctcgt tccaccgtta       960
     gaagaagttg gcgagtatac gtattatttc cgggcaacaa tgaaagacca aaccactttg      1020
     acatcagatg attatacagt cgaaccaatt tggaaacact ggtcagagga agcggcagtt      1080
     tgtgaaacag agcaaggctt aatggtttta tttaaagaaa atccatcaag tatcatcccg      1140
     gtcgagttca ccgcgaaatc agatgaactt gtaatcggat taaaaccttc atttgaagcg      1200
     agcaatgtta aaacaaaatc atccggccaa ttgaaaaaag atgatttaga gattatcgtt      1260
     tcaaacaatc cagtgcgtct cgaagtacat tttaaaggca acttaattct agaatcgcat      1320
     aaaatttacc cagcgttaca gtggtataca gataagactg gcgcaatcaa caaagtgaaa      1380
     ctgcatttag atgctccgaa agaagaagag tattacggct tcggtgaacg atacaatgca      1440
     ttaggtcagc gcgggaatgt gcttgattgt tttgtttata atcaataccg tgatcaagga      1500
     acaagaacct acatcccgat gccgttttat catacgaatc gtgattatag tgtgttcgtt      1560
     gataccgctc gttacacaag ttttgattta ggtaaccaac tagcggacaa gcatacaatt      1620
     acagtagaaa taaatggctg tgacacagat atttgtcttt taatgggaga tattcgtagt      1680
     gcagtagcaa attatatgaa gaaaactggg aaaccggcga tggtgccagt ttgggcgctt      1740
     gggccgtgga tgtctagtaa caactgggac cgtgaatctg tcgttcgaac agaagtggaa      1800
     acaacgcaag aattgcaaat cccatcaacc gttgtcgtgt tagaacaatg gagcgatgaa      1860
     gcgacttatt atatgttcaa tgacgccgaa tatgacgaaa aagccccatc tgaagcatat      1920
     aattacgatg aaattagatt cccttcatgg ggtagatggc cagatccaaa agggatggtt      1980
     gactatatcc atgacaacaa aatgaagtta attctttggc aaattccgat tcaaaaatac      2040
     ttaaatcgcc aacaacaccc actaaaagac cgcgaagaag cctatatgat tgaaaaaggc      2100
     tatgtagtga aaaatccgga tggctcgcca taccgtattc cagaaaattg gttcacagaa      2160
     agcttgatta tggatttctc caatgaagaa ggaaaaaaat ggtggtttga caaacgacaa      2220
     tacttaattg atattggggt cgatggcttt aaaacagacg gcggcgaatt cgtctttggt      2280
     gaaggtttgc aatttgctga tggtagacgt ggtgatgaaa tgcgtaatct ttatccaaat      2340
     gactatgtgg aagcttacta ccaatttgcg caacaaaatg atggcatgac atttagtcgt      2400
     gctggctaca ctggcgcgca aaacttcccg gcgcactggg ctggagacga acgttccact      2460
     tttgatgcat ttagaagatc gctcattgct ggactttccg ctggattttc gggaattccg      2520
     ttttggagtt ttgactttgc aggttttaac ggcgatattc cgacggctga gctattcatt      2580
     cgttctgctg aaatggctac tttctgcccg attatgcagt atcatgctga aagtaaagcg      2640
     gaatttaatc aagaccggac accgtggaat attgcttcac ggactggtga cgactcggtc      2700
     atccctattt accgccattt tgcgaatgtt agaatgaata ttttacctta tatttataat      2760
     gaatcattaa aatgtgttga aactggtttg ccgatgatgc gtgcgcttct gctggactat      2820
     aaagaagatc cgcgtgtttc tgatatgtat gaccaatact tattcggaga agcaatgctg      2880
     atcgcaccag taattgaaga cggcgtgcgc tccagagaag tttatctgcc agaaggaact      2940
     tggtatgatt tctggaatgg aacaaaagtg aacggaccaa ctttacgaaa atgcaaagcg      3000
     gataaagaag aaattccagt tttcattcgt ggtggaaaag cagtgctatg taatgtggac      3060
     gctacattga aactcggctc atgggttggc aacacagtgg aagaatacga tacaccacta      3120
     cttaaaattt atgtggacgg tgatttcaca gaagaaatga cggatcactt atccgaaaaa      3180
     tggctagtaa aagtaacgga aaatgcggac gaagtagttg tttctgttca aacaaacaca      3240
     ccggcatatg aagttgaagt aatcggcacg accaaaaaag tacaaataaa gaaagggaga      3300
     taa                                                                    3303
//

If you have problems or comments...

PBIL Back to PBIL home page