(data stored in ACNUC10821 zone)

EMBL: AE017262.PE194

AE017262.PE194       Location/Qualifiers
FT   CDS_pept        196047..197273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37546; match to
FT                   protein family HMM PF03990; match to protein family HMM
FT                   PF06725; match to protein family HMM PF07501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02984"
FT                   /protein_id="AAT02984.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGEKVVEYKVTFENGKEKKRDVIKENVTSKKTDKV
FT                   VVRGTKEKVVATPVSNVSTPSTTSSSSSSSSSTPSGGKTYRMESTAYSGGGTTAYGINL
FT                   SANPGLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGR
FT                   RMVTVKVLN"
     atgaccatgg aaaacagcag taacgtagcc caatcatcaa aatggaaatt accaatcatg        60
     attgcaggat ttgttattgt agtagcattg gttttttatt tcgttttcga aggaactaaa       120
     aacgatatca ctatagtaaa cgctggtgaa aaaattgaat caagaacaca tgcgaaaact       180
     gtttcagaag cattagacga agcaggtatt aaagtaagtg aacgcgatga aattgcgcca       240
     ggcaaaaatg cagaaatcaa agacggcatg gaaattaaat atttgccagc tcgtcaaatt       300
     acaataaatg ataatggtac taaaaaagac gtttggagca caaaagcaaa cgtagcagac       360
     ttgcttaaag atgaaaatat tacaactcgt ccgcaagatg tattaaacgt agcattagat       420
     actaaattga aaaatggcct tgaagttaac attaatcgtg ccattcaact ttccttacaa       480
     aacggagcaa aaaaagatac agtatggaca acaaaaacaa aagttagtga tttactagct       540
     gagaaaaata ttaaacttga tcaagatgac cgtgtgtcac ctgcaaaaga cagtaactta       600
     aaagaaaaaa tgactgtaga agttacatat gtcaattcaa aagcagaaaa gaaaaatgaa       660
     caagttaaat tcgaaacagt atataaagaa gacgatagcc taaacaaagg cgttgaaaaa       720
     gtcgttcaag aaggtaaaaa cggcgaaaaa gttgttgagt ataaagtaac atttgaaaat       780
     ggcaaagaga aaaaacgtga tgtcattaaa gaaaatgtca cttctaaaaa aactgataaa       840
     gtagttgtac gtggcacgaa agaaaaagtg gtagcaacac cagtttctaa cgtatctact       900
     ccaagtacaa cgtcatcatc atcgtcatca tcatcatcaa ctccatcagg tggtaaaaca       960
     tacagaatgg aatctactgc atattcaggt ggcggtacta cagcttatgg tatcaaccta      1020
     agtgccaacc ctggactaaa agtaattgcg gttgatccac gaattattcc acttggctct      1080
     aaagtttggg ttgagggata cggagaagca atcgctggag atactggcgg cgctatcaaa      1140
     ggaaatatcg ttgacgtgta tttcccaaat gaaagtcagt gctattcatg gggtagaaga      1200
     atggtgactg tcaaagtgtt aaactaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page