(data stored in ACNUC10821 zone)

EMBL: AE017262.PE203

AE017262.PE203       Location/Qualifiers
FT   CDS_pept        203559..204767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0206"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02993"
FT                   /protein_id="AAT02993.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKNSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGI
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
     atgaatgttc tccaaagcat gaaaatggca tggaaacaat taaaggcaag taaattaagg        60
     tcttttctaa ccatgctagg tattattatt ggtgtcgcat ccgttattct tttagtatct       120
     ctagggaatg gtgtaacgca agaagttgat gaccaaatgg gcgatttggg ttcgaattta       180
     attacagtag ttaatagctc tgttaatcca aacgacaaat atacgtatga tgaagtaatg       240
     aaatatcaaa acattgatgg agtcaaaagc gtttctccag aattatctgg acaagtcaat       300
     gcaacttttg attataagaa ttcaagtaat aaggtgatag gcacgaatga ccaatataag       360
     gccgcgcgta gcctagaaat gaaagaaggg cgtttcctac taccgattga taccgaatat       420
     ggccagaaag tagctgtaat aggctctacg gtagcaagtg atctatttgg ttttggggat       480
     ccgattggcg aaaccattag attaaacgga atgccttaca aagttgttgg tgtcttgaaa       540
     gaaaaaggcg cgtctatgat gggatcgagc gatgaccaaa tctttattcc gatttcttcc       600
     gctcaaaggc tcctaaaaga tacaaatgtc cgtacaatct atgtagaaac aaaatctgcc       660
     gaagatgttg attttgtagt aaacacacta gaatcacgtc ttgcgattaa atttggtgac       720
     gaaaaagaac aagaaaaaaa tgcgtcatcc gcacaaatgg gaccatctta tcaagtcatt       780
     aatcaacaag agattctcaa tgctttcaac acgattagta caacgctaac tactgcgctt       840
     ggtgcgattg ctgctatttc acttgttgtt ggtggtattg gaattatgaa tattatgcta       900
     gtttctgtta gtgagcgaac gagagagatt ggtataagaa aagcgctcgg agctaaaaaa       960
     cgagccatcc tgttacaatt cctaattgaa tccattgtta ttagtgtctg tggtgggatt      1020
     atcggtatta ttatcggggt ctcaggagcg ctcatatttg gctcagtcgc aggtatatcg      1080
     tcaggaataa ctgcaggaac cattatcttc tccttcgtat tctcactatg tatcggagtg      1140
     atatttggta tcgcacctgc taataaagct tcgaaattaa gaccaattga cgcattaaga      1200
     tccgaataa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page