(data stored in ACNUC10821 zone)

EMBL: AE017262.PE206

AE017262.PE206       Location/Qualifiers
FT   CDS_pept        206573..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0209"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="identified by similarity to SP:P14192; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   PF00483; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02996"
FT                   /db_xref="GOA:Q724L5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L5"
FT                   /protein_id="AAT02996.1"
FT                   /translation="MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLN
FT                   VDKVVTIVGHGAEKVQEHLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDGVTLVVCGDT
FT                   PLIEASTMEALLKYHHEKRAKATILTTVIEDPTGYGRIIRDDLGIVEKIVEHKDATEKE
FT                   QRISEINTGTYCFDNKALFEALENVSNDNVQGEYYLPDVIKILKDSDEVVAAYRMESFE
FT                   ESLGVNDRIALAEASRLMQRRINENHMRNGVTLVNPENTYIDIDVKIGQDTVIEPGVML
FT                   RGETVIGDDCVVTSGSEIVNSVIGERVHVRTSSIFESKVGDDVQIGPYAHLRPESDIHD
FT                   HVKIGNYVETKKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKNKAKTIIGD
FT                   NVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPDDALGIARAKQDNKLGYAKHLNHGK"
     atgtcaaaac gatatgctgt agtgcttgct gctggccaag gcacacggat gaaatcaaaa        60
     ctttacaaag tattgcatcc tgtttgtgga aaaccaatgg tcgaacatgt agtagatcaa       120
     atttcgacgc ttaatgttga taaagtggtt acaattgtag gtcacggagc tgagaaagta       180
     caagagcatt tagctggtaa aagcgagttt gtaaagcaag aagagcaact cggaacggcg       240
     catgcagtac tgcaagcgaa agcggaactt gcaggtaaag atggtgtgac gctcgttgtt       300
     tgtggggaca cgcctttaat cgaagctagt acgatggaag ctttactgaa atatcaccat       360
     gaaaaacgtg caaaagcaac tattcttaca acggttattg aagatcctac aggttatggt       420
     cgtattattc gtgatgacct aggcattgta gaaaaaatcg tagaacataa agatgcaaca       480
     gaaaaagaac aacgtatttc ggaaattaac actgggacat attgctttga taataaagct       540
     ctttttgaag cgttagagaa tgtttctaac gataatgtgc aaggagaata ttacttacca       600
     gatgttatta agattttaaa agattcggat gaagtcgttg cggcttacag aatggagtct       660
     tttgaagagt cacttggagt gaacgaccga attgccctag ctgaagcatc cagattaatg       720
     caacgtcgaa ttaacgaaaa tcatatgcgt aatggagtaa cgcttgttaa tcctgaaaac       780
     acgtatattg atatagatgt aaaaattggt caagatacag taattgaacc aggagttatg       840
     cttcgtgggg aaactgtaat cggtgatgat tgcgtggtta caagcggctc ggaaatcgta       900
     aacagtgtta tcggtgaacg agtacacgtc agaacttctt ctattttcga aagtaaagtt       960
     ggcgatgacg ttcaaattgg cccatatgcg cacctaagac cagaatctga cattcacgat      1020
     catgtgaaaa tcgggaacta cgtcgaaacg aaaaaagcag tggttggtga aggaactaaa      1080
     ttaccacatt tcatttacat gggagatgcg gaaattggta aaaacgtcaa tgttggttgc      1140
     ggaagtattg ctgttaatta cgacggcaaa aacaaagcga aaaccatcat tggggataat      1200
     gtctttgttg gctgtaattc aaacctgatt gcacctgtca aagtgggaga tcgagctttc      1260
     atagctgctg gttccacgat tacaaaagat gttcctgacg acgcgctagg cattgctcgt      1320
     gcgaaacaag acaacaaact tggttatgca aaacatttga atcacggtaa ataa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page