(data stored in ACNUC10821 zone)

EMBL: AE017262.PE215

AE017262.PE215       Location/Qualifiers
FT   CDS_pept        218078..218539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0218"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06998"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03005"
FT                   /protein_id="AAT03005.1"
FT                   /translation="MKMLKKGTTVLFVMIMAVMLVACGDKEETKTYSLSQNGVDSKLTY
FT                   TYKGDKVTKQTAENTMSYASLGVASKEDAEKMLKATSDKFQGIDGLKEKIEYKDDKAIE
FT                   TLEVDYTKISSEDMNKIPGMSSNGDTSKGISMEESAKMLESQGYKEVSK"
     atgaaaatgc ttaaaaaggg tacaacggtt ttatttgtaa tgattatggc ggttatgtta        60
     gtcgcgtgtg gggacaaaga agaaacgaaa acttactcac tttcccaaaa tggtgttgat       120
     tctaaattaa catacacata taagggagac aaagttacta aacaaacagc tgagaacaca       180
     atgtcatatg cttcgctagg tgttgcttca aaagaagacg ctgaaaaaat gcttaaagca       240
     acaagcgata aattccaagg tattgatggt ttaaaagaaa agattgaata taaagatgat       300
     aaagctattg aaacactaga agtagattac actaaaatct cttcggaaga tatgaacaaa       360
     atccctggta tgtcttcaaa cggtgatact tctaaaggga ttagcatgga ggaatctgca       420
     aaaatgctag aatcccaagg ctataaagaa gtttcaaaat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page