(data stored in ACNUC10821 zone)

EMBL: AE017262.PE219

AE017262.PE219       Location/Qualifiers
FT   CDS_pept        220978..221601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0222"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03009"
FT                   /db_xref="GOA:Q724K2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K2"
FT                   /protein_id="AAT03009.1"
FT                   /translation="MATTLEVQKRETTQHSEVTRLRSEGKVPGIIYGYKSENVPVSVDS
FT                   LELIKAVRDNGRNAVFSVTVDGKKLNVLLHEYQVDPLKDVLVHVDLLAVDMNEEVETDV
FT                   RVVLVGDAPGVKAGGVLQQIIHDVKVSATPEKLPETIELDISSLEIGDVLTTNDLPENK
FT                   DYVVQAEEEETVVTVSAPRAEEEPTTTEAPEPEAVHGKDEEPVE"
     atggcaacaa cattagaggt ccagaaaaga gaaacaacgc aacattcaga agtaacgaga        60
     ttgcgtagtg aaggaaaagt acctggaatt atttatggct acaaatcgga aaatgttcca       120
     gtttccgttg attctttgga attaatcaaa gcagttcgtg acaatggtcg taacgccgta       180
     ttttcagtta ctgtggacgg caagaaatta aacgttttat tacatgaata tcaagtagat       240
     ccgttaaaag acgtattagt acacgttgat ttactagcgg ttgatatgaa tgaagaagtt       300
     gagacagatg ttcgtgtggt attagttggg gatgcaccgg gagttaaagc tggcggcgta       360
     ctacaacaaa ttatccatga tgtaaaagtt tcagcaacac cagaaaaatt accagaaaca       420
     attgaattag acatttcttc attagaaatc ggtgatgttt taacaacgaa cgaccttccg       480
     gaaaacaaag actatgtcgt gcaagcggag gaagaagaaa cagtagtaac tgtatctgct       540
     ccacgtgcgg aagaagaacc aacgactacg gaagcacctg aaccagaagc tgtacatggt       600
     aaagatgaag aacctgttga ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page