(data stored in ACNUC10821 zone)

EMBL: AE017262.PE22

AE017262.PE22        Location/Qualifiers
FT   CDS_pept        26275..27015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0023"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02812"
FT                   /protein_id="AAT02812.1"
FT                   /translation="MAEPKYAIIINDIKRLISDGTFKPGEKIYSEDELKKKYNVSNTTV
FT                   VRALHELVRAGILARYQGKGTYVSKSIINEEVIFNEYTTVPNGRFNRKTKITNEHTKVV
FT                   AINEIQDARIAKKLQIPPENMIVHFQRIRLIDDVPWTVQNNYMAKSNLINVDLTNFERF
FT                   NSLSEVIKELYGINILHEAMKERIEVEFPVKDKNNFKLLEIDSELPLYHIERITYVPEG
FT                   QPYEYIESYLRHNFYSIEIEKKKQ"
     atggcggaac caaagtacgc tattattatc aatgatatca agcgattaat tagtgacgga        60
     acttttaagc caggggaaaa aatttattcg gaagatgaac tgaaaaagaa atacaatgtt       120
     agtaatacga cagttgttcg agcattacat gaattagtac gagctgggat tttagctcgt       180
     tatcaaggaa aaggcacata cgtgagtaag tctattatta acgaagaagt tatttttaat       240
     gaatatacga cagtgccgaa cggaagattc aatcgtaaaa caaaaattac taacgaacat       300
     acaaaggtag ttgcaataaa tgaaattcag gatgcgcgaa ttgctaaaaa attgcagatt       360
     ccccctgaaa atatgattgt tcattttcaa cgaatccgcc ttattgatga tgtgccttgg       420
     accgtacaaa ataactatat ggcaaaatcc aatttgatca acgtagattt aaccaatttc       480
     gaaagattta attctttatc tgaagtaatt aaagagcttt atggtattaa tattctgcac       540
     gaagcgatga aggagcgaat tgaagtcgaa tttccagtaa aagacaaaaa taattttaaa       600
     ttactcgaaa ttgactccga gttaccactt taccacattg aaagaataac ctatgtgcca       660
     gaggggcaac cctatgaata tattgaaagc tacttgcggc ataattttta ctctattgaa       720
     attgaaaaga aaaaacaata g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page