(data stored in ACNUC10821 zone)

EMBL: AE017262.PE220

AE017262.PE220       Location/Qualifiers
FT   CDS_pept        221691..222275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0223"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03010"
FT                   /protein_id="AAT03010.1"
FT                   /translation="MLDKSVPHISAIMVNHDATNYPEFHLPEGYSFCFYKDGLEEDWCR
FT                   LQLETGQVLSMDSIRARFETEFGNEKEKLAKRCVFVEAPNGEIIGTAMLWDGNTFGEMA
FT                   SRIHWVAVLDSHGGKGIAKALLSKILGLNKSSFVYLTTQTGSYQAIYLYQKFGFEKYVG
FT                   KTPENWKTVNFQEEKEAAWQIIENKIAEHQA"
     atgcttgata agtcagtacc gcacatttct gctattatgg tcaatcacga tgctacaaat        60
     tatccggagt ttcatttacc tgagggatat tctttttgct tttataaaga tggtttggaa       120
     gaagactggt gtagattgca attagaaacg ggtcaagtgc tttcaatgga cagtattcgc       180
     gctcgttttg aaacggaatt cggaaatgaa aaagaaaaat tagccaagcg ctgcgtcttt       240
     gtagaggcgc caaatggtga aattattgga acggctatgc tttgggatgg aaatacattc       300
     ggcgagatgg cgagtcggat tcactgggtt gcagtgcttg attcgcacgg tggaaaaggt       360
     atcgcgaaag ccttgttatc caaaattctc ggcttgaata aaagtagttt tgtctattta       420
     actacgcaaa ccggaagtta tcaagctatc tatttatatc agaaattcgg ttttgaaaaa       480
     tacgtcggaa aaacgccgga aaattggaaa acagtcaatt ttcaagagga aaaggaagcg       540
     gcctggcaaa ttatcgaaaa taaaattgcc gaacaccaag cctag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page